KEGG   Caenorhabditis briggsae: CBG18231Help
Entry
CBG18231          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG18231
  KO
K11129  H/ACA ribonucleoprotein complex subunit 2
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    CBG18231
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cbr03009]
    CBG18231
   03032 DNA replication proteins [BR:cbr03032]
    CBG18231
Ribosome biogenesis [BR:cbr03009]
 Eukaryotic type
  Sno RNPs
   Box H/ACA snoRNPs
    CBG18231
DNA replication proteins [BR:cbr03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    Dyskerin complex
     CBG18231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae RNase_P_pop3 BID ADP_ribosyl_GH
Motif
Other DBs
NCBI-GeneID: 8584241
NCBI-ProteinID: XP_002642246
WormBase: CBG18231
UniProt: Q60YI3
Position
III
AA seq 163 aa AA seqDB search
MGKRNLDETMNESAVSEIAEDVAALTTEKDEYQALCELVNPIAQPLANRKLAKKVYKLIK
KAAAGEKTLREGIKDVQKELRKNEKGICILAGNVSPIDVYSHIPAICEEKEIPYVYIPSR
EQLGLAVGHRRPSILIFVKPSADFQELYDEVAETLHHLTVDAA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcgcaatcttgatgagaccatgaacgagtcggcagtttcagagatcgccgaa
gacgtcgcggccctgaccaccgagaaagatgagtatcaagcactttgcgagctggtaaac
ccaatcgcccaaccactagccaaccgcaaactggcaaagaaggtgtacaagctcatcaag
aaggcagctgccggcgagaaaactcttcgcgagggtatcaaagatgtccagaaggagctg
cgcaaaaacgagaaaggaatctgcattcttgcaggaaacgtttccccgatcgacgtctac
tcgcacatcccagcgatctgtgaagaaaaggaaatcccatatgtgtacattccatctcgc
gaacagctcggactagccgtcggtcatcgtcgtccatccattctgatcttcgtcaagcca
agcgctgacttccaggagctctacgacgaggtcgccgagactctccaccatctcactgtt
gatgctgcctaa

DBGET integrated database retrieval system