KEGG   Caenorhabditis briggsae: CBG18349Help
Entry
CBG18349          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG18349
  KO
K02890  large subunit ribosomal protein L22
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CBG18349
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cbr03011]
    CBG18349
Ribosome [BR:cbr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CBG18349
  Bacteria
    CBG18349
  Archaea
    CBG18349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 8584346
NCBI-ProteinID: XP_002642352
WormBase: CBG18349
UniProt: A8XSI0
Position
III
AA seq 258 aa AA seqDB search
MLRVLVRSGTEACRAVSTSSAVLSIPVKKEDLSAKEIWERRSKLRIPKLQKDEQLSSKVY
FAPEWDLEQKPNMEEGFVDPLKGYGMTPEKWEYYNKVVWPPNYIVPETGLPKAKEVFHCK
ESVHFSPKRMWAACQLVWKMNVDEAITQLDMQQLKGCILLMETLKKAKTRAADEFHIEYP
SQMYVADAFPVQSNIVKGARRHAHENWNTIRYRYIHIFVRLEEGPAPAHKQRHAPKSGWD
HMDEYYNYLRSRSVKYSI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttacgagtgctggttcgatctggaaccgaggcatgtcgagcagtcagcacatcctct
gccgtcctctctattccagtcaaaaaagaggatctctcagcgaaagagatttgggaacga
cgttcgaaactccgcattccaaaacttcaaaaagatgagcagctatcgtcgaaagtctac
ttcgcaccagaatgggatttggagcagaaaccaaacatggaagaaggctttgttgaccca
ctgaagggatacggaatgactccagagaaatgggagtactataataaagttgtctggcca
ccaaattatattgtgccggagactgggcttccgaaagcaaaagaagtgttccactgcaaa
gaatccgttcacttttcgccaaaaagaatgtgggccgcctgtcaattggtttggaaaatg
aatgttgacgaggctatcacacagttagatatgcagcagttgaagggttgcatattattg
atggagacacttaaaaaagctaaaaccagagctgctgacgagtttcatattgaatatcca
tcgcagatgtatgttgccgacgcgtttccggtacaatcgaatattgtgaaaggagctcgt
cgtcatgctcacgagaactggaatactatcagatatcgctacattcacatttttgtccga
cttgaagagggacccgcgccagctcacaaacaacgacacgcaccaaaaagcgggtgggat
cacatggatgagtactacaactacctccgctcacgatccgtcaaatatagcatctag

DBGET integrated database retrieval system