KEGG   Caenorhabditis briggsae: CBG18935Help
Entry
CBG18935          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG18935
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CBG18935
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CBG18935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 8579251
NCBI-ProteinID: XP_002637256
WormBase: CBG18935
UniProt: A8XUD9
Position
V
AA seq 309 aa AA seqDB search
MVENNTLFVTGGVVVVSSIAIYLYLKTTKTCPFSACKKTSKRTLLDDSVKYSLPLIEKFE
ISHDTRKFRFGLPSKDHILGLPIGQHVYLSATIDGKLIVRPYTPVSSDEDKGFVDLMVKV
YFKNTNEKFPDGGKMSQYLESLKIGDTISFRGPQGNIVYKGQGLFSLKADKKSEPTNRSF
KHLSMIAGGTGITPMLQVIAAILRDPTDSTQIRLLFANQTEDDILCRQELDDLEAKHPDR
FRVWYTIDRPPAVWKYSSGFINDNMIKENLFPPGPDSAVLMCGPPPMINFACTPNLDKLE
YDPANRLLF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaaataacactctttttgtgactggaggtgtcgttgtggtctctagtattgca
atttacttgtacctgaagactacaaaaacctgtccgttttcagcatgtaaaaaaacttca
aaaagaacgcttctcgatgattcagtcaaatactcacttccattaatcgaaaagttcgag
atcagtcatgatacgagaaagttccgatttggacttccatccaaggatcacattcttgga
cttccaattggacaacacgtctacctcagtgctacgatcgatggaaagctcatcgttcgt
ccatatactccagtatccagtgacgaagacaagggattcgtcgatttgatggtcaaggtt
tatttcaagaataccaatgaaaagttcccagatggtgggaaaatgagtcaatacttggag
agcctcaagatcggagacacgatcagcttccgtggaccacaaggaaacattgtctacaag
ggacagggacttttcagtttgaaagccgacaaaaaatcggaaccaacaaatcgcagcttc
aaacatctgtccatgattgcgggaggaacaggaatcacacctatgcttcaagttatcgca
gcgattcttcgtgatccaaccgattccacacagatcagactcttattcgctaatcagaca
gaagatgatattctgtgtagacaagagctcgatgatttggaggctaagcatccagaccgc
ttccgtgtttggtatactatcgacagaccgccagcagtttggaagtattcctctggattc
atcaatgacaatatgatcaaggagaacctcttcccaccaggaccggattcggctgtcctg
atgtgcggcccaccaccaatgattaatttcgcctgcactccaaatctcgacaaactcgag
tatgatccagccaatcgtctccttttctag

DBGET integrated database retrieval system