KEGG   Caenorhabditis briggsae: CBG19784Help
Entry
CBG19784          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG19784
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00450  Selenocompound metabolism
cbr00970  Aminoacyl-tRNA biosynthesis
cbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CBG19784
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CBG19784
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbr01007]
    CBG19784
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbr03016]
    CBG19784
Enzymes [BR:cbr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CBG19784
Amino acid related enzymes [BR:cbr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CBG19784
Transfer RNA biogenesis [BR:cbr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CBG19784
 Prokaryotic type
   Other AARSs
    CBG19784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 8582712
NCBI-ProteinID: XP_002640717
WormBase: CBG19784
Position
I
AA seq 474 aa AA seqDB search
YVTSPIFYANAEPHIGHAYTAVLCDTAHRWNQLKNFKDKESKALFSIGTDEHGTSQLAGT
TPKQFCDQVSSKFSTLFDTLNISHTNFIRTTDPKHAESVQHFWRVLQDRGHIYKSSYSGY
YSISEECFIPENEVEENAENKMVLKTTGTAVEWIEEENYMFRLSEFREKVGEWIEKTDVV
WPVKYKSLALDSLTLDGDLSISRARKRLSWGISVPDDPSQTIYVWLDALVNYLTVSGYPK
DRLVWPPTCQVIGKDITKFHLYYWPAFLMAADLPLPQRVFVHGHWLVDNVKMSKSLGNVV
NPKHAIDKFTSEGLRYFLLKQGNPSNDCSFSWNSCLETVNSDLVNNVGNLLNRSTVEKIN
KSGTYPRRVELEKKVKEDTEKLLEMLEESREKCEELYDDMYYYKGIEQLMLTMKEANRVF
QLSQPWKETDSERLESLLFVTYETIRIVSILLQPITPKMANFCLDRLGVDQRNL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
tatgtcacatctcctattttttatgcaaatgctgaacctcacatcgggcacgcctacaca
gcagtgttgtgtgacactgctcatcgatggaatcagttgaagaatttcaaggataaagaa
tcgaaagcattgttttcaataggaaccgatgagcatgggacctcacagctcgccggaaca
acacccaagcagttttgcgatcaagtatcttcaaaattctccactcttttcgacacacta
aacatctcgcacacaaacttcatcagaactactgacccaaagcatgcagaatctgtgcag
cacttctggagggtacttcaagacagaggacacatctacaaaagcagttattctggatat
tatagcatttctgaggaatgcttcattcctgagaatgaggtggaggagaatgcggaaaac
aagatggttctgaagacaacaggcaccgctgtggaatggattgaagaggagaattatatg
tttcggctgtcggaattccgagaaaaagtgggcgaatggattgagaagacggacgttgtg
tggcctgtcaagtacaaatcgctggctctggatagtttgacgttggacggcgatttgtcg
atttcaagggcgagaaagcggctgtcttggggcatttcggtacccgacgatccctcgcag
acaatttacgtatggctggatgccttggtgaattatttaactgtctcgggatacccaaaa
gatagacttgtatggccaccaacctgccaggttattggcaaggatatcacaaaattccat
ctctactactggcctgcattcctgatggccgctgatctacccctcccccagcgagtattc
gttcatggtcattggctagtggacaatgtaaaaatgtcaaaaagcctgggaaacgttgtg
aatccaaaacacgcaatcgataaattcacttctgaaggtctccgatactttctcctaaaa
caaggaaacccaagcaatgattgcagtttcagttggaatagttgtctagaaaccgttaat
agtgatttggtgaataatgtaggcaatttgctgaatagaagtactgtagagaagataaat
aagagtgggacatatcctagaagagtggaattggagaaaaaggtgaaagaagacaccgaa
aagctcctggagatgctagaagagagcagagagaaatgtgaggagctctacgatgatatg
tactactacaaaggcatcgagcagttgatgctgacgatgaaggaggcgaatcgagtgttc
caattgagtcaaccatggaaagagacggattcggagagacttgagagtctcctttttgtg
acttatgagacaattcgaattgtttcgattcttcttcaacccatcactccaaaaatggcg
aatttctgtttagatcgactaggagtagatcaaaggaatttg

DBGET integrated database retrieval system