KEGG   Caenorhabditis briggsae: CBG20269Help
Entry
CBG20269          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG20269
  KO
K00560  thymidylate synthase [EC:2.1.1.45]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00240  Pyrimidine metabolism
cbr00670  One carbon pool by folate
cbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CBG20269
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CBG20269
Enzymes [BR:cbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     CBG20269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymidylat_synt
Motif
Other DBs
NCBI-GeneID: 8582360
NCBI-ProteinID: XP_002640365
WormBase: CBG20269
UniProt: A8XXD3
Position
I
AA seq 315 aa AA seqDB search
MNKENIVPETIELPSQEKSGKEIAQHVNQDEFKYLKQVEQILQEGSRRDDRTGTGTISIF
GMQSKYSLRNDTIPLLTTKRVYWKGVLEELLWFISGSTDGKLLMAKNVKIWEKNGDRAFL
DNLGFTSREEGDLGPVYGFQWRHFGAKYVDCHTDYTGQGIDQLAEVIRQIKEEPDSRRII
LSAWNPSELGQMVLPPCHTMCQFYVDNGELSCQLYQRSGDMGLGVPFNLASYGLLTHMIA
KVCGLKAGTLVHTLGDAHVYSNHVDALKTQMEREPYAFPKIRFTRDVSSIDDFTSDMIVL
EDYKCHGKIVMDMAV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagaaaatattgttcctgaaaccatcgaacttcctagccaggaaaaatctgga
aaggaaatcgcgcaacatgtgaatcaagacgaattcaaatacttgaagcaagttgagcaa
attttgcaagaaggctctcgtcgagacgatcgtaccggaacgggaaccatctcgattttt
ggaatgcaatcgaagtatagtttgagaaatgacacaatcccactgctgacaacgaaacga
gtctactggaaaggtgttcttgaagagcttctctggttcatttctgggtccaccgatgga
aaattattgatggcgaaaaatgtcaagatttgggagaagaacggtgatcgtgcgttcctt
gacaatttgggattcacgtctcgcgaagaaggagatctcggaccggtttacggattccaa
tggagacatttcggagctaaatacgtggattgtcatacggattacactggacaaggtatt
gatcagctagctgaagtcattcgacaaatcaaggaagaaccggacagcagaagaatcatt
ttgtcggcgtggaatccatcggaactcgggcagatggttctaccaccatgtcatacaatg
tgccagttctacgtggataacggagagttgtcttgtcagctatatcagcgaagtggagac
atgggcctcggagtgccgttcaaccttgccagctatggtcttctgacccatatgattgct
aaggtgtgtggattgaaagctggaactcttgtgcacactctcggcgacgcccatgtctac
tcgaatcatgtggatgcattgaagactcaaatggaacgagaaccgtatgcattcccgaaa
attcgattcacacgagacgtcagctcgatcgacgatttcacttctgacatgattgttctc
gaggactacaagtgccacggaaagattgtcatggatatggctgtttaa

DBGET integrated database retrieval system