KEGG   Caenorhabditis briggsae: CBG21178Help
Entry
CBG21178          CDS       T01054                                 

Gene name
Cbr-hap-1
Definition
(RefSeq) C. briggsae CBR-HAP-1 protein
  KO
K01519  inosine triphosphate pyrophosphatase [EC:3.6.1.-]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00230  Purine metabolism
cbr00983  Drug metabolism - other enzymes
cbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CBG21178 (Cbr-hap-1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    CBG21178 (Cbr-hap-1)
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     CBG21178 (Cbr-hap-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-GeneID: 8584778
NCBI-ProteinID: XP_002642784
WormBase: CBG21178
UniProt: A8XZP2
Position
III
AA seq 184 aa AA seqDB search
MTLRKINFVTGNAKKLQEVKEILKGFEVTNVDVDLNEYQGEPEFIAQKKCQEAVEAVKGP
VLVEDTSLCFNAMGGLPGPYIKWFLTNLKPDGLYNMLTGFADKTAYAQCIFAYTEGLGKP
IHVFAGKCPGQIVAPRGDTSFGWDPCFQPDGFEETFGEMDKDVKNEISHRSKALDLLKEY
FEKN
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacccttcgaaagatcaattttgtgactggaaacgcgaaaaagttgcaagaagtcaag
gagattttaaaggggtttgaggtcaccaatgtggacgtcgatctgaacgagtatcaagga
gagcccgaattcattgctcagaaaaagtgtcaagaggcggtcgaagcggtcaagggacca
gttttggtcgaggacacgagtttgtgcttcaacgcaatgggcggtctcccaggaccatat
atcaagtggttcttgacaaatttgaaacccgacggactttacaatatgttgactggtttc
gccgacaagaccgcctacgctcagtgcattttcgcctacaccgagggactcggaaagccg
attcacgtttttgctggaaaatgcccgggacaaattgtcgcgccacgtggcgacacctca
ttcggctgggatccatgcttccagccggacggtttcgaggaaacctttggagaaatggat
aaggacgtcaaaaatgagatttcgcatcgatccaaagcgctggaccttctaaaagagtac
tttgagaagaattga

DBGET integrated database retrieval system