KEGG   Caenorhabditis briggsae: CBG23724Help
Entry
CBG23724          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG23724
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00220  Arginine biosynthesis
cbr00250  Alanine, aspartate and glutamate metabolism
cbr00471  D-Glutamine and D-glutamate metabolism
cbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CBG23724
   00220 Arginine biosynthesis
    CBG23724
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CBG23724
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CBG23724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_2 Ank_4
Motif
Other DBs
NCBI-GeneID: 8588087
NCBI-ProteinID: XP_002646163
WormBase: CBG23724
Position
I
AA seq 577 aa AA seqDB search
MAFLKPLDPNKRAFSGLLFDTKRNRKMMEYDFYRVNTVISDVKVCRSMSYDMCGNHQQEL
LFDLYKDETTGKVYLPRFFKALLESGIRKDDPRIDKMIQNIKDADLLDDFVWGSQHIYLE
KDTFKKYIGSSIGVVTKALKKQMIIPDWERFVGDMGEIFEDVRGFNEGELATYIPQLSRV
PPDSWAMSVCTIDGQRKSWGDSLNPFCLQSVSKPFTYALVHDDIGPEALHAHVGQEPSGR
LFNDISLDHNKKPHNPLINAGAIVVASLLKNKTPLADRFDFMIHACRKFVGSGYIGFNNS
VFLSERETADRNYALSYYMREHNVFPKDLNLQDTLDLYFQICSIETNCDSLAVMAATLAN
GGVNPMNGERVVNNRACRDTLSLMYSCGMYDWSGQFAFHVGLPAKSGVSGDMIIVIPNVM
GIALYSPRLDKLGNTVRGVKFAEQLVQKYNFHNYDSLIYSDNKKIDPRRQLKDDHDGQNR
FMYATKLGDIAAIKRFLLMGHDIHCKDYDNRTVLHVAAAEGDVVTLEYVLSKWQEDPDPL
DRYDRTPLDDAKHFNHTACIKLLEEAITVFNLKQQDD
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcctttttgaagccgctcgacccgaacaaaagggctttttctggattactttttgac
acaaagcggaatagaaaaatgatggaatacgacttttaccgagtgaacactgtgataagt
gatgtaaaagtgtgtcgttcgatgtcgtacgatatgtgtggaaatcatcagcaagagctg
ctcttcgatctttacaaggatgagacgacaggaaaagtctatcttccacgatttttcaag
gctttgcttgaaagcggaatccgaaaagacgatcctcgaatcgacaaaatgattcaaaac
attaaagatgctgatcttctggatgattttgtatggggctcccaacacatttatttggaa
aaggacacattcaagaaatacattggaagtagcattggagtggtgacgaaggcattgaag
aagcagatgatcataccggattgggaacggttcgttggagatatgggagagatttttgaa
gatgttcgaggattcaatgaaggagaactggcaacgtatattccacaactatcacgagtt
ccacctgatagttgggcaatgtctgtatgtacgattgatgggcaaaggaagagctgggga
gactcattgaatccgttctgtctgcaaagtgtttcaaaacccttcacttatgctctggtt
catgatgatattggaccggaggcgttgcatgcacacgtgggacaagaaccttctggaaga
ctattcaacgatatcagtttagatcataataaaaaaccccacaatccactaatcaacgct
ggtgcgatcgtcgttgcttcgctgctcaaaaacaagactccactggcagatcgcttcgat
tttatgatccacgcgtgccggaaattcgtcggaagtggatacattggattcaacaactcg
gtatttttgtctgaaagagaaacggctgatcgaaattatgctctatcgtactacatgagg
gaacacaacgtctttccgaaagatttgaatctccaagacactcttgatctctacttccaa
atttgttccatcgagaccaactgtgattcattggctgtaatggctgccacgttggcgaat
ggtggagtgaatccgatgaatggtgaacgggttgtgaataatcgtgcgtgccgagacaca
ctttctctgatgtactcatgtggaatgtacgattggtcgggtcagtttgcattccatgtt
ggtctccctgcaaagtctggagtatctggagatatgataattgtgataccaaatgtgatg
ggcattgcattgtacagtccacgactagacaaattgggaaatacggttagaggagtgaag
tttgcggagcagttggtacagaagtataatttccacaattatgatagtttgatttactcg
gacaacaaaaagattgatccccgtcggcaactgaaagacgatcatgatggtcagaataga
tttatgtatgccacaaaattgggagacattgctgcaatcaaacgattcctactgatggga
cacgatattcattgcaaagattacgataacagaacagttttacacgtggcagctgccgaa
ggagacgtcgttacattggaatacgttctgagcaaatggcaggaagatcctgatccactt
gatagatacgatcgaactcctttggatgatgcgaaacattttaaccacacggcgtgtatc
aaacttctcgaagaggcaattactgttttcaatctcaagcaacaggatgattag

DBGET integrated database retrieval system