KEGG   Caenorhabditis briggsae: CBG24154Help
Entry
CBG24154          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG24154
  KO
K03941  NADH dehydrogenase (ubiquinone) Fe-S protein 8 [EC:1.6.5.3 1.6.99.3]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00190  Oxidative phosphorylation
cbr01100  Metabolic pathways
Module
cbr_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    CBG24154
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     CBG24154
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     CBG24154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_16 Fer4_21 Fer4_10 Fer4_9 Fer4_8 Fer4_6 Fer4_2 Fer4_4 Fer4_17 Fer4_13 c-SKI_SMAD_bind Fer4_3 Fer4_18 ETF_QO EPF
Motif
Other DBs
NCBI-GeneID: 8585179
NCBI-ProteinID: XP_002643185
WormBase: CBG24154
UniProt: A8WK35
Position
III
AA seq 212 aa AA seqDB search
MALKSVAVLTKGMFGRMPAQLAISSVPSNTIQRRSNYKFVGMPNETDGTVAGDLNYGLHT
VFFTELFRGFGVMLGHVFMEPATINYPFEKGPLSSRFRGEHALRRYPSGEERCIACKLCE
AICPAQAITIEAETRPDGSRRTTRYDIDMTKCIYCGLCQEACPVDAIVEGPNFEYSTETH
EELLYNKEKLLLNGDRWEPELASNLQAEYLYR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaaaagtgtggcagtgctgacaaaaggcatgttcggaagaatgccggcccag
ctcgccatcagcagtgtcccatcaaataccatccaaagacgatccaactataaattcgtc
ggaatgcccaatgagaccgacggaaccgtggcaggcgatttgaactatggtcttcacacc
gttttcttcaccgagcttttccgaggatttggagtgatgcttggtcacgtcttcatggag
ccagccaccatcaattaccctttcgaaaagggacctctcagctcgagattcagaggagag
cacgcccttcgtcgttatccatctggagaggaacgttgcatcgcctgcaaattgtgcgaa
gctatttgccccgctcaagcgatcaccatcgaagcagagacccgtccagatggttcccgt
cgtacaactcgttatgatatcgacatgactaagtgtatctattgtggactttgtcaagag
gcttgtccagttgacgctattgtcgaaggaccaaatttcgagtattctactgaaactcac
gaagaattgctctataataaggagaaacttcttctgaatggagatcgttgggaaccggaa
ttggcatcgaatcttcaggctgaatatctctatcgctaa

DBGET integrated database retrieval system