KEGG   Citrobacter braakii: A6J81_04320Help
Entry
A6J81_04320       CDS       T04825                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbra  Citrobacter braakii
Pathway
cbra00071  Fatty acid degradation
cbra00072  Synthesis and degradation of ketone bodies
cbra00280  Valine, leucine and isoleucine degradation
cbra00310  Lysine degradation
cbra00362  Benzoate degradation
cbra00380  Tryptophan metabolism
cbra00620  Pyruvate metabolism
cbra00630  Glyoxylate and dicarboxylate metabolism
cbra00640  Propanoate metabolism
cbra00650  Butanoate metabolism
cbra00900  Terpenoid backbone biosynthesis
cbra01100  Metabolic pathways
cbra01110  Biosynthesis of secondary metabolites
cbra01120  Microbial metabolism in diverse environments
cbra01130  Biosynthesis of antibiotics
cbra01200  Carbon metabolism
cbra01212  Fatty acid metabolism
cbra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6J81_04320
   00630 Glyoxylate and dicarboxylate metabolism
    A6J81_04320
   00640 Propanoate metabolism
    A6J81_04320
   00650 Butanoate metabolism
    A6J81_04320
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A6J81_04320
   00072 Synthesis and degradation of ketone bodies
    A6J81_04320
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A6J81_04320
   00310 Lysine degradation
    A6J81_04320
   00380 Tryptophan metabolism
    A6J81_04320
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A6J81_04320
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A6J81_04320
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A6J81_04320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbra04147]
    A6J81_04320
Enzymes [BR:cbra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A6J81_04320
Exosome [BR:cbra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A6J81_04320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ARC40007
Position
856059..857264
Genome map
AA seq 401 aa AA seqDB search
MQDVVIVAATRTPIGSFHGALAPLSAVELGSVVIRSLLEKTAVTPEQIDEVILGQVLTAG
CGQNPARQTALRAGLPVTTPALTINLVCGSGLKAVHQAVQAIRCGDAQIVIAGGQESMSN
APYFLDGARAGLRLGHASMKDSVVHDGLWDAFNDYHMGITAENLADKFAISREQQDAFAL
RSQQKAAAAIEGGRFSAEITPVSVPQGKKPPRVVDHDEQPRPDTQADKLAQLKPAFRPGN
GTVTAGNASSINDGAAAVMLMSAAKAAELNLPVMGRVAGYAVSGVDPAIMGIGPVEASLQ
CLKRAGWTLNDVDLIEANEAFAAQALAVGESLNWDGNRVNVNGGAIALGHPIGASGCRIL
VTLLHEMSRSNAVKGLATLCVGGGQGVALAVERSQEASHAK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgttgttattgtcgcggcaacgcgcaccccgattggcagttttcatggcgca
ctggcgccgctttcggcggttgaactgggttcggtggtgatccgttcgttgctggaaaaa
acagccgtgacccctgagcaaattgatgaagtgattttaggtcaggtcctgacggcgggc
tgcggccagaatccggccagacaaacggcattacgcgcaggcctgccggtaactacgccg
gcgttaaccattaatctggtgtgcggctcgggccttaaagcggtgcatcaggcggtacag
gctattcgctgcggcgatgcgcaaatcgtgattgccggtgggcaagagagcatgagcaat
gcgccctattttctcgatggcgctcgggcgggcctgcgactgggtcatgccagcatgaaa
gacagcgtggtgcatgacggtctgtgggatgcgttcaacgactatcacatgggcattacc
gccgaaaatctggcggataagtttgccattagtcgtgagcagcaggacgcttttgccctt
cgctcccagcaaaaagccgccgccgccattgaaggtggtcgttttagcgcggaaatcacg
ccggtcagcgtcccacagggcaaaaaaccgccgcgtgtagtggatcatgacgaacagcca
cgtccggatactcaggccgataaactggcgcagctcaagccagcatttcgcccaggtaac
ggcacggtgaccgccgggaatgcctcgtcaatcaatgatggcgccgccgcggtaatgttg
atgagcgccgccaaagcggcagaactcaacctgccggttatgggccgggtggcgggctac
gccgtctccggcgtcgaccctgcgattatgggcattgggccagtagaagcgtcactccag
tgcctgaagcgagcgggctggacgttaaatgatgtcgatctcattgaagccaacgaagcc
tttgccgcacaagcgctggcggttggcgaatccctgaactgggacggtaatcgggtgaac
gtgaacggcggagcgattgcgctgggccatcccattggtgcttcaggttgtcgaattctg
gtgacactgctgcatgaaatgtcccgcagcaatgccgtcaaagggctggctacgctgtgc
gtaggcggcggtcagggcgtagcactggcggtggaacgttcgcaggaggcatctcatgca
aagtaa

DBGET integrated database retrieval system