KEGG   Citrobacter braakii: A6J81_09350Help
Entry
A6J81_09350       CDS       T04825                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
cbra  Citrobacter braakii
Pathway
cbra00630  Glyoxylate and dicarboxylate metabolism
cbra00660  C5-Branched dibasic acid metabolism
cbra01100  Metabolic pathways
cbra01120  Microbial metabolism in diverse environments
cbra01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A6J81_09350
   00660 C5-Branched dibasic acid metabolism
    A6J81_09350
Enzymes [BR:cbra01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     A6J81_09350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: ARC40902
Position
1867226..1868467
Genome map
AA seq 413 aa AA seqDB search
MKIKKALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGDPVTPGFTSVRQAGECVSVQLILE
NGAVAVGDCAAVQYSGAGGRDPLFLAENFIPFLNDHIKPLLEGRDVDAFLPNARFFDQLR
IDGHLLHTAVRYGLSQALLDAAALATGRLKTEVVCDEWQLPCVPEAIPLFGQSGDDRYIA
VDKMILKGVDVLPHALINNVEEKLGFKGEKLREYVRWLSDRILSLRTSERYHPTLHIDVY
GTIGLIFDMDPVRCAEYIASLEVEAQGLPLYIEGPVDAGNKPDQIRMLTAITKELTRLGS
GVKIVADEWCNTYQDIVDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHAMEAYQGGT
CNETEISARTCVHVALAARPMRMLVKPGMGFDEGLNIVFNEMNRTIALLQTKD
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaaaggcccttttcaccgctggctactcctcattttattttgacgatcag
caggccatcaaaaatggcgccggtcatgacgggtttatctataccggcgatccggtaacg
cctggatttacctctgttcgtcaggcgggtgaatgcgtttccgtgcagctgattctggaa
aatggcgcggtagcggtgggcgattgcgcagcggtgcaatattcaggcgcaggcggtcgt
gacccgctgttcctggctgaaaactttattccgttcctcaacgatcacatcaaaccgctg
ctggaaggccgtgacgttgatgcgttcctgccaaacgcccgtttctttgaccaactgcgt
attgacggtcatctgctgcataccgccgtccgctatggtttgtctcaggcgctgctcgac
gctgcggcgctggctaccggtcgtctgaaaactgaagtggtttgcgatgaatggcaactg
ccgtgcgtgccggaagccattccattatttggtcagagcggcgacgaccgttatatcgcc
gttgataagatgatccttaaaggtgtggacgtcctgccgcatgcgctgatcaacaacgtg
gaagagaagctgggctttaaaggcgaaaaactgcgtgagtatgtacgttggttatccgac
cgcatcttaagcctgcgcaccagcgaacgttatcacccgacgctgcacattgatgtgtac
ggcacgatcggtctgatcttcgatatggatccggtgcgctgcgctgaatacatcgccagc
ctggaagtcgaagcccagggtctgccgctgtatatcgaaggtccggttgatgccggcaac
aagccggatcagatccgcatgttgaccgccatcaccaaagagctgactcgtctgggttcc
ggcgtgaaaattgtcgccgacgaatggtgtaacacctatcaggatatcgtggactttacc
gatgcgggcagctgccacatggtacagatcaagactccagatcttggcggcattcataac
attgttgatgcagtgctgtactgcaacaaacacgccatggaagcctatcagggcggcacc
tgtaacgaaaccgagatcagtgcccgcacctgcgtacacgtggcacttgccgcgcgtcca
atgcgcatgctggttaaaccgggtatgggtttcgatgaaggtctcaacatcgtgtttaac
gaaatgaaccgcaccatcgcgttgttgcaaactaaggattaa

DBGET integrated database retrieval system