KEGG   Citrobacter braakii: A6J81_11725Help
Entry
A6J81_11725       CDS       T04825                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cbra  Citrobacter braakii
Pathway
cbra00052  Galactose metabolism
cbra00500  Starch and sucrose metabolism
cbra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A6J81_11725
   00500 Starch and sucrose metabolism
    A6J81_11725
Enzymes [BR:cbra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     A6J81_11725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ARC41336
Position
complement(2391599..2393035)
Genome map
AA seq 478 aa AA seqDB search
MTSLLEQTEQTLEKAQADINPRWYPRYHLAARAGWMNDPNGLVWFDGWYHAFYQHHPYSP
EWGPMHWGHARSKDLVHWEHMPVALAPEGPADVDGCFSGSAVVDGDTLALIYTGHKFHGS
PDTDDNLYQVQCLATSRDGIHFERHGMVIDTPSGLHHFRDPKVWREGERWYMVVGSRVEN
TGQVRLYSSSDLRKWQDEGIFAEADEGMGYMWECPDFFTLEGKRVLMFSPQGIAAEGYRN
RNLFQSGYLLGEWQQGQPFTHDGQFIELDHGHDFYAPQSFLTPDNRRIVIGWLDMWESPM
PEQQDGWAGMLSLPRELSLGDDYRVRMKPADEVTALRGSYYPTPACCLRNQKVLITADAE
AVEVQLVWDLNASTAEQFGMALGDGLRIYADNQAQRLIVERRYPEYSLVGTRSIPLPADG
LLTLRIFIDRSSVEVFVNDGDACLSSRIYPHPAQRDLSLFANHGVATLQQAGYWSLDK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacatccttgttagaacagaccgaacagacgcttgaaaaagcacaagccgatattaat
ccgcgttggtatccgcggtatcacctcgctgctcgcgcaggctggatgaacgatcctaac
ggcctggtatggtttgatgggtggtatcatgcgttttatcaacatcacccttattctcct
gaatggggaccaatgcactgggggcatgctcgcagcaaagatttggtgcactgggaacat
atgccagtcgcgctggcgccggaaggtccagcagatgtggacggctgtttctccggctcc
gccgtggtggatggcgatacgctggcgctgatttataccggacataaatttcacggttcg
ccagacacagacgacaatctctaccaggtgcagtgcctggcaaccagtcgtgacggtatc
cattttgagcgacatggtatggtcattgatacaccgtcagggctgcatcattttcgcgat
ccgaaggtatggcgcgaaggtgagcgctggtacatggtggtcggttcccgtgtggagaat
acggggcaggttcgtctgtatagttcatccgatctccgtaaatggcaagacgaagggata
tttgccgaggctgatgaaggaatgggatatatgtgggaatgccctgatttctttactctg
gaagggaagcgggtgctgatgttttctccgcaggggatcgcggcggaaggttatcgcaat
cgcaacctttttcagagcggttatttacttggtgaatggcagcaaggtcaaccattcacc
catgatggacaatttattgagctggaccacggtcatgacttttatgctccgcaaagcttt
ctgactccggataatcgtcgcattgttatcggttggttggatatgtgggaatcgccgatg
cctgagcagcaggacggctgggccggaatgttgtctctaccgcgtgaactgagccttggt
gatgactatcgggtgaggatgaaacccgctgacgaagtcaccgcgctgcgtggcagctat
tatccaacacccgcgtgttgcctgcgtaatcagaaagtccttattacggctgatgccgaa
gcggtcgaggtacaactggtatgggatctgaacgcctctacggctgaacagtttggtatg
gcattaggggatggactaagaatttacgccgataatcaagctcagcgtctgatagtggag
cgtcgctatccagaatattcgctggtaggaactcgcagtattccgttgccagcagacggt
ttactgacattacgtatatttatcgaccgctcatcagtagaggtatttgttaatgatggt
gatgcgtgcttaagtagccgaatatatcctcacccggcccagcgcgatctttcactgttt
gcgaatcatggagttgccacattacagcaagccggatactggtctttagataaataa

DBGET integrated database retrieval system