KEGG   Citrobacter braakii: A6J81_20530Help
Entry
A6J81_20530       CDS       T04825                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
cbra  Citrobacter braakii
Pathway
cbra00561  Glycerolipid metabolism
cbra00640  Propanoate metabolism
cbra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A6J81_20530 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    A6J81_20530 (gldA)
Enzymes [BR:cbra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     A6J81_20530 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase PFK FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ARC42908
Position
4197098..4198195
Genome map
AA seq 365 aa AA seqDB search
MLKVIQSPAKYLQGPDASTLFGQYAKNLADSFFVIADDFVMKLAGEKVLNGLHNHDISCH
AERFNGECSHAEINRLIAILKQHGCRGVVGIGGGKTLDTAKAIGYYQKLPVVVIPTIAST
DAPTSALSVIYTEAGEFEEYLIYPKNPDMVVMDTAIIAKAPVRLLVAGMGDALSTWFEAK
ACYDARATSMAGGQSTVAALSLARLCYDTLLAEGEKARFAAQAGVVTDALERIVEANTYL
SGIGFESSGLAGAHAIHNGFTILEECHHLYHGEKVAFGTLAQLVLQNSPMEEIETVLNFC
QKVGLPVTLAEMGVKEDVDGKIMAVAKATCAEGETIHNMPFPVTPESVHAAILTADLLGQ
QWLAR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagttattcaatctccagccaaatatctccagggtcctgacgcttccaccttg
tttggtcaatacgctaaaaatctggcggacagctttttcgtgatcgcggatgacttcgtg
atgaagctggcgggagagaaagtactcaacggcctgcacaaccacgacattagctgccac
gcggaacgcttcaacggcgaatgcagccatgctgaaattaatcgtctgattgccattttg
aaacagcacggttgccgcggtgtggttgggattggcggcgggaaaacgctggataccgcc
aaagcgattggctactaccagaagctgccggtggtggtgatcccgactatcgcgtctacc
gatgcgccaaccagtgcgctgtccgtaatctataccgaagccggtgagtttgaagagtat
ctgatctacccgaaaaacccggatatggtggtgatggataccgcaatcattgctaaagcg
ccggtacgtctgctggtggccgggatgggcgatgcgctctcgacctggtttgaagcgaaa
gcctgttatgacgccagagcgaccagcatggcgggcggacagtccaccgtggcggcgctg
agcctggcgcgcctgtgctatgataccctgctggcggaaggcgagaaggcacgctttgcc
gcgcaggctggcgtggtgaccgatgcgctggagcgtattgtcgaagctaacacttacctc
agcggcatcggctttgaaagcagcggtctggcaggggcgcatgcgatccacaacggcttt
acgattctggaagagtgccaccatttgtaccacggtgaaaaagtcgcctttggtacgctg
gcgcagctggtgttgcaaaacagcccgatggaagagatcgaaaccgtgctgaatttctgt
cagaaagtaggcctgccggtaacgttagcggaaatgggcgtgaaagaagacgttgacggc
aagatcatggccgtagcaaaagcgacctgtgcagaaggtgaaaccatccacaatatgccg
ttcccggtaacgcctgaaagcgtacatgccgctattttgacggcagacctgctgggacag
cagtggctggcgcgttaa

DBGET integrated database retrieval system