KEGG   Citrobacter braakii: A6J81_22945Help
Entry
A6J81_22945       CDS       T04825                                 

Definition
(GenBank) L-2-hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
cbra  Citrobacter braakii
Pathway
cbra00310  Lysine degradation
cbra01100  Metabolic pathways
cbra01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    A6J81_22945
Enzymes [BR:cbra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     A6J81_22945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo Pyr_redox_2 Amino_oxidase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ARC43335
Position
complement(4729141..4730409)
Genome map
AA seq 422 aa AA seqDB search
MYDFVIIGGGIIGMSTSMQLIDVYPDARIALLEKESGPACHQTGHNSGVIHAGVYYTPGS
LKAQFCLAGNRATKAFCDQNGIRYDVCGKMLVATSSLEMERMRALWDRTAANGLEREWLN
AQELREREPNITGLGGIFVPSSGIVSYREVTAAMAKIFQAKGGEIIYNAEVSALKEHAAG
VIVHTRQGQEFEGATLISCSGLMADRLVKMLGVEPGFIICPFRGEYFRLASEHNQIVNHL
IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSLSDTLEILGSSGIRR
VLQNNLRSGLGEMKNSLCKSGYLRLVQKYCPSLTQNDLQPWPAGVRAQAVSPDGKLIDDF
LFVTTPRSIHTCNAPSPAATSAIPIGAHIVSKVHALLENQSNSGRTLRAARSVETLHAAF
TR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattttgtgattattggcggcggcattatcggcatgtctacctccatgcaactg
attgatgtctatccggacgccagaatagcgctgctggaaaaagagtccggtccggcctgc
caccagacgggccataacagcggcgtaattcatgccggggtctattacacccccggcagc
ctgaaggcgcaattttgcctggccggtaatcgcgccacaaaagccttttgcgaccaaaac
ggcatccgctacgacgtctgcggaaaaatgctggttgctacctcctcactggaaatggag
cgcatgcgggcgctttgggatcgcaccgccgctaacggcctggagcgcgaatggctgaat
gcgcaggagctacgcgagcgtgaacccaatatcaccgggctgggcggcattttcgtcccg
tcgagcgggatcgtcagctaccgtgaagtgaccgccgcgatggcgaagattttccaggcc
aaaggcggagagattatttacaacgccgaggtcagcgcgctaaaggagcacgctgcgggc
gtgatcgtccatacccgccaggggcaggaatttgagggggcaacgctgattagctgctct
ggtctgatggcggaccgactggtgaaaatgctcggcgttgaacccggctttatcatctgt
ccattccgtggcgaatatttccgcctggcgtcagaacataaccagatagttaaccatctg
atctaccccatccccgacccggcgatgccgtttctcggcgttcatctgacccggatgatt
gacggtagcgtcaccgtgggtcccaacgcggtactggcatttaagcgtgaaggctatcgt
aaacgagacttctcgctcagcgatacgctggagatcctcggttcttccggcattcgccgc
gtgctgcaaaacaacctgcgttcagggcttggcgaaatgaagaattcgctgtgcaaaagc
ggctatctgcggttggtgcaaaagtactgcccaagtctgacgcagaacgatctgcagccc
tggcctgcgggcgtgcgggcgcaggcggtgtcacctgatggcaagctaatagacgatttc
ctgtttgtcacaacgccacgctcaattcacacctgtaacgccccttctccggcggcaacg
tcggcgatccctatcggcgcgcatattgtcagcaaagttcatgcgctactagagaaccag
agtaattccggacgcacgctgcgtgcggcacgtagcgtggagacattacacgccgcattc
acccgttaa

DBGET integrated database retrieval system