KEGG   Citrobacter braakii: A6J81_24325Help
Entry
A6J81_24325       CDS       T04825                                 

Definition
(GenBank) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
cbra  Citrobacter braakii
Pathway
cbra00860  Porphyrin and chlorophyll metabolism
cbra00970  Aminoacyl-tRNA biosynthesis
cbra01100  Metabolic pathways
cbra01110  Biosynthesis of secondary metabolites
cbra01120  Microbial metabolism in diverse environments
Module
cbra_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
cbra_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cbra00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A6J81_24325
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A6J81_24325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbra01007]
    A6J81_24325
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbra03016]
    A6J81_24325
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:cbra02048]
    A6J81_24325
Enzymes [BR:cbra01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     A6J81_24325
Amino acid related enzymes [BR:cbra01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   A6J81_24325
Transfer RNA biogenesis [BR:cbra03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A6J81_24325
 Prokaryotic Type
   Other AARSs
    A6J81_24325
Prokaryotic defense system [BR:cbra02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    A6J81_24325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c HTH_15 Apolipoprotein
Motif
Other DBs
NCBI-ProteinID: ARC43580
Position
5059041..5060456
Genome map
AA seq 471 aa AA seqDB search
MKIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDG
MNWLNLEWDEGPYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKERLDALREEQMANGEKPR
YDGRCRHGHEHHAADEPCVVRFANPQEGSVIFDDQIRGPIEFSNQELDDLIIRRTDGSPT
YNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPVYAHVSMINGDDGKKLSK
RHGAVSVMQYRDDGYLPEALLNYLVRLGWSSGDQEIFTREEMIKLFSLGAVSKSASAFNT
EKLQWLNHHYINALAPEYVATHLQWHIEQENIDTRVGPQLSELVKLLGERCKTLKEMAQS
CRYFYEDFAEFDADAAKKHLRPVARQPLEVVRDKLAAISEWTAENVHHAIQATADELEVG
MGKVGMPLRVAVTGAGQSPGLDVTVHAIGKSRSIERINKALAFIAERESQQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaactcgcttcgcgccaagcccgacaggttacctgcacgtcggcggtgcg
cgtactgctctttattcctggctttttgcacgtaaccatggcggtgagtttgtgctgcgt
attgaagacaccgatctcgaacgctccacgccggaagctattgaagccattatggatggc
atgaactggctgaatctggaatgggatgaaggcccgtacttccagaccaaacgttttgat
cgctacaacgctgtgattgatgagatgctggaagcaggtactgcatataaatgctactgc
tccaaagagcgtctggacgcgctgcgcgaagagcaaatggcgaacggtgaaaaaccgcgt
tacgacggccgctgccgccacggccacgaacatcacgctgctgatgaaccttgcgtggtg
cgttttgccaacccgcaggaaggttccgttatttttgacgaccagatccgtgggccgatc
gaattcagcaaccaggagctggacgatctgatcatccgccgtaccgacggttctccgacc
tacaacttctgcgttgtggttgacgactgggatatggaaatcactcacgtcattcgtggt
gaagaccatatcaacaatactccacgtcagatcaacatcctgaaagcgctgaatgcgccg
gtaccggtttatgcgcacgtgtcgatgatcaacggcgacgatggtaaaaaactctccaaa
cgtcacggtgcggtcagcgttatgcagtatcgcgacgacggttacctgccggaagcgctg
ctgaactatctggtgcgtctgggctggtccagcggcgatcaggaaatcttcactcgtgaa
gagatgatcaaactgttctcccttggtgcagtgagcaaatctgccagtgcgttcaacacc
gaaaaattgcagtggttgaaccatcactacattaatgcgctggcgccggaatatgtggca
acgcatctgcaatggcacattgagcaggaaaatatcgatacccgcgttggcccgcagctg
tcagagctggttaaactgctgggcgagcgttgcaaaacgctgaaagaaatggcgcagagc
tgccgctatttctacgaagactttgctgagttcgatgctgacgcggcgaagaaacacctg
cgtccggtagcgcgtcagccgctggaagtggttcgcgacaagctggctgcgattagcgag
tggacggcagaaaacgtgcaccacgcgattcaggcaaccgctgatgagctggaagtgggt
atgggtaaagttgggatgccgctgcgcgtagccgttaccggggcaggtcagtctccggga
ttagacgtcacggtgcatgcgattggtaaatcccgcagcattgagcgtattaataaagcg
ctggcatttattgctgagcgtgaaagccagcagtaa

DBGET integrated database retrieval system