KEGG   Citrobacter braakii: A6J81_24680Help
Entry
A6J81_24680       CDS       T04825                                 

Definition
(GenBank) histidine ABC transporter permease HisQ
  KO
K10016  histidine transport system permease protein
Organism
cbra  Citrobacter braakii
Pathway
cbra02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cbra00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A6J81_24680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbra02000]
    A6J81_24680
Transporters [BR:cbra02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    A6J81_24680
   Histidine transporter
    A6J81_24680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ARC43639
Position
5137449..5138135
Genome map
AA seq 228 aa AA seqDB search
MLYGFSGVILQGAIVTLELALSSVVLAVLIGLVGAAAKLSQSRAMALIFEGYTTLIRGVP
DLVLMLLIFYGLQIALNTVTDAIGIGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP
KGHIEAATAFGFTSSQIFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWEPFYFAVVCGVIYLVFTTVSNGVLLYLERRYSVGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatggcttttcaggtgttattttacagggcgcaattgttacgcttgagctggca
ctcagctcggtggtactggcggttctgataggcttagtcggcgcggcagcaaagctgtcg
caaagccgggcgatggcgcttatattcgaagggtacaccacgcttatccgcggcgtgccc
gatctggtcttaatgctgctcattttctacggattacaaatcgcgctgaacaccgttacc
gatgccatcggtatcggccagattgatatcgatccaatggtcgcgggtatcattacactc
gggtttatctacggcgcctattttaccgaaacatttcgtggcgcatttatggccgtgcca
aaaggccatattgaagccgcgacggcattcggttttaccagctcacaaatatttcgccgc
ataatgttcccggcgatgatgcgctatgccttaccgggaattggcaacaactggcaggtc
attcttaaggccacggcgctggtatcgttgcttggacttgaagacgtggtgaaagccact
cagcttgccgggaagagtacctgggagccgttctattttgccgtagtgtgcggggtcatc
tatctggtgtttaccactgtatctaatggtgtgctgctgtaccttgagcgccgctattcc
gtgggtgtgaagagggctgacctgtga

DBGET integrated database retrieval system