KEGG   Citrobacter braakii: A6J81_24915Help
Entry
A6J81_24915       CDS       T04825                                 

Definition
(GenBank) lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase
  KO
K07264  4-amino-4-deoxy-L-arabinose transferase [EC:2.4.2.43]
Organism
cbra  Citrobacter braakii
Pathway
cbra00540  Lipopolysaccharide biosynthesis
cbra01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cbra00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    A6J81_24915
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    A6J81_24915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cbra01003]
    A6J81_24915
   01005 Lipopolysaccharide biosynthesis proteins [BR:cbra01005]
    A6J81_24915
Enzymes [BR:cbra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.43  lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase
     A6J81_24915
Glycosyltransferases [BR:cbra01003]
 Polysaccharide
  Bacterial polysaccharide
   A6J81_24915
Lipopolysaccharide biosynthesis proteins [BR:cbra01005]
 Lipid A
  A6J81_24915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT PMT_2
Motif
Other DBs
NCBI-ProteinID: ARC43682
Position
complement(5185457..5187115)
Genome map
AA seq 552 aa AA seqDB search
MKSAARYTLAFIAFIALYFILPINSRLLWQPDETRYAEISREMLTSGDWIVPHFLGLRYF
EKPIAGYWLNSIGQWLFGANNFGVRAGAIFATLLTALLVAWLAMRLWQDKRTAVLSSVIF
LTFFLVYSIGTYAVLDPIIALWLMAGMCCFWQGMQATTRTRKMTAFLLLGLTCGMGVMTK
GFLALAVPVLSVLPWVFAQKRWKDLIHYGLLAVVGCVVIVLPWGIAIARREPDFWHYFFW
VEHIQRFAQDDAQHKAPVWYYIPIFVAGALPWLGLLPGALRTGWRERDVPRSTLYLLSWI
IMPILFFSIAKGKLPTYILSCFAPLAILMARFGLQAAEKGSAALRVNGWINVLFGVTGIV
ATFIVSTLGPLKTPVWSHIETYKVFCAWGIFIVWTLFGWYTLNNREKNWPFAALCPLGLA
LLFGFSIPDRVMESKQPQFFVEMTKESLDTSRYILTDSVGVAAGLAWSLKRDDIMMYGQT
GELKYGLNYPDAQGRFVSREDFADWLAQHRQQGNITLVLSIDKDEDINQLAIPPADYIDN
QGRLVLIQYRPK
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgctgcccgctacactctggcgttcatcgcttttattgcgctgtattttatt
cttcccatcaacagtcgcctgctctggcagccagatgagacgcgctatgccgaaatcagc
cgggagatgctgacctctggcgactggatcgttcctcactttttagggctgcgttatttt
gaaaaaccgattgccggatactggttaaacagcatcgggcaatggttgtttggcgccaat
aattttggcgtcagagcgggggccatttttgccaccttgctgacggcgctactggtagcc
tggcttgccatgcggttatggcaggataagcgtaccgccgtactctcatcagttatcttt
ttaacgttttttttggtatacagcatcggcacctacgcggtacttgatcctatcatcgcg
ctctggctaatggcgggcatgtgttgtttttggcaggggatgcaggccaccaccagaacg
cgcaaaatgactgcctttttgctgttagggttaacctgcggcatgggcgtaatgaccaag
ggtttcctggcgcttgccgttccggtgctcagcgtactgccgtgggttttcgcacaaaag
cgctggaaagatctcatacactacggtctgctggcggtcgtcggctgcgtcgtgattgtg
ctgccgtggggaatagcgattgcccggcgtgagccggatttctggcattatttcttctgg
gtcgaacacattcaacgcttcgcgcaggatgatgctcaacacaaggctccagtctggtac
tacatcccgatatttgtagcgggcgcattaccgtggctcgggctgcttcccggcgcactg
cgtacgggctggcgtgagcgagatgttccgcgcagcacactgtacctgctaagctggatt
atcatgccaatcctttttttcagcatcgcgaaaggaaaattgccaacctatattctttcc
tgcttcgcgccgctggcgatattgatggcgcgtttcggcctacaggccgcggaaaaaggc
tcagccgcgctgcgcgtcaatggctggatcaacgttctgttcggtgtgaccgggattgtc
gccacgtttattgtttccacgctgggcccgttaaagacgccggtctggtcgcatatcgaa
acgtataaggtgttttgtgcgtggggtatttttatcgtctggacgctgttcggctggtat
acgctaaataaccgcgagaagaactggccattcgcagcgctgtgcccattgggactggca
ctgctgtttggcttttccattcctgaccgggtgatggaatctaaacagccacagtttttt
gtcgagatgaccaaagagtcgctggacacgagccgttatattctcaccgatagcgttggc
gtcgccgcggggctggcctggagcctgaagcgtgacgacatcatgatgtacggacaaacg
ggcgagttaaaatatggccttaactacccggatgcccaggggcgttttgtcagtcgggaa
gactttgccgactggttagcgcaacatcgtcagcaaggaaacattacgctcgtgctctcg
attgataaggatgaagatattaatcaacttgccatccctcccgctgattacattgataat
caggggcgtctggtcctgattcagtatcgacccaaatga

DBGET integrated database retrieval system