KEGG   Coxiella burnetii RSA 331: COXBURSA331_A0689Help
Entry
COXBURSA331_A0689 CDS       T00632                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbs  Coxiella burnetii RSA 331
Pathway
cbs00071  Fatty acid degradation
cbs00072  Synthesis and degradation of ketone bodies
cbs00280  Valine, leucine and isoleucine degradation
cbs00310  Lysine degradation
cbs00362  Benzoate degradation
cbs00380  Tryptophan metabolism
cbs00620  Pyruvate metabolism
cbs00630  Glyoxylate and dicarboxylate metabolism
cbs00640  Propanoate metabolism
cbs00650  Butanoate metabolism
cbs00900  Terpenoid backbone biosynthesis
cbs01100  Metabolic pathways
cbs01110  Biosynthesis of secondary metabolites
cbs01120  Microbial metabolism in diverse environments
cbs01130  Biosynthesis of antibiotics
cbs01200  Carbon metabolism
cbs01212  Fatty acid metabolism
cbs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    COXBURSA331_A0689
   00630 Glyoxylate and dicarboxylate metabolism
    COXBURSA331_A0689
   00640 Propanoate metabolism
    COXBURSA331_A0689
   00650 Butanoate metabolism
    COXBURSA331_A0689
  09103 Lipid metabolism
   00071 Fatty acid degradation
    COXBURSA331_A0689
   00072 Synthesis and degradation of ketone bodies
    COXBURSA331_A0689
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    COXBURSA331_A0689
   00310 Lysine degradation
    COXBURSA331_A0689
   00380 Tryptophan metabolism
    COXBURSA331_A0689
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    COXBURSA331_A0689
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    COXBURSA331_A0689
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    COXBURSA331_A0689
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbs04147]
    COXBURSA331_A0689
Enzymes [BR:cbs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     COXBURSA331_A0689
Exosome [BR:cbs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COXBURSA331_A0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABX78821
Position
604223..605518
Genome map
AA seq 431 aa AA seqDB search
MAKPIYIVDGARTPFIKARGKPGPFSASDLAVAAGRALLNRQPFDRTDFDEVIMGCIMPS
ENEANIGRLIALRLGCGKDMPGWTVQRNCGSGMQAIDSAMKDIALGRADLVLAGGTEAMS
RAPLILNEKMVNWLADWQQAKSFRDKFTVMSRLRPHYFKPIIALLRGLTDPVCELIMGQT
AEVLAHQFNITREAMDAYALRSHQRLAAAQENGYLKEIVPLFTDEGKFYDRDDGVRPDTS
LKKLAQLKPIFDRKFGEVTAGNSSQVTDGASLVIVASEKAVKKYRLPVLGRIVDVEWAAL
APEVMGLGPVFAATPLLQRNRLTLEDIDYWEMNEAFAATILACQKAWASEEFCKKYLGLE
KAVGQLDEEKLNIDGGAIAIGHPVGTSGARIVLHLLEILKRKKAKRGIAALCIGGGQGGA
MLLEREAGGKD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccaatctacatcgtcgacggagcgcgtacgccttttatcaaagcgcgcgga
aagcccggtcctttttcagcgtctgatttagccgtcgctgcggggcgcgcgttattaaat
cgccagccgtttgatcggactgattttgacgaagtcattatgggctgcatcatgccgagc
gaaaacgaggccaatatcgggcggttaattgcattgcgtttaggctgtggaaaagatatg
cccggctggaccgtgcaacgcaattgcggttcaggaatgcaggccattgattcagcgatg
aaagacatcgctttaggtcgtgcggatcttgtcttagccggtggcacagaagcaatgagc
cgtgcacccttaattttaaatgaaaaaatggtgaattggttagcggactggcaacaagcc
aaaagttttcgtgacaaattcactgtcatgagtcgtttacgcccccattatttcaaaccg
attatcgccttattgcggggtcttacggatcctgtgtgtgaattaattatgggacaaacg
gctgaggtgcttgcgcatcaattcaatattacccgtgaagccatggacgcctatgcttta
cgcagccaccaacgtttggccgccgcgcaagaaaatggttacctgaaagaaattgttcct
ctttttactgacgagggaaaattttatgatcgggacgatggtgttcgcccagacacctct
ctcaaaaaattagcgcagttaaaacctatttttgatcgcaaatttggagaagtaaccgcg
gggaacagttctcaagtcaccgatggggcaagcttggtcattgtcgctagcgagaaagcc
gtaaaaaaatatcgactgccggtgctaggtcgaatcgttgacgttgaatgggccgcttta
gcgccagaggtgatgggtctcggtccggtttttgcggcgactcccctgttacaacgcaat
cggttaacgcttgaagatatcgattattgggagatgaatgaagcttttgcggccacgatt
ttagcttgtcaaaaagcgtgggctagcgaggaattttgtaaaaaatatttaggcctggaa
aaagccgttggccaattagatgaagaaaaattaaatatcgatggcggcgccattgccatt
ggccatccggtgggaacgagcggcgcgcgaatcgtccttcatttattggaaattctaaaa
cgcaaaaaagcaaagcgcggcatcgctgcgctttgcatcggcggtggccaaggcggggcg
atgttgttggagagagaagcaggtggtaaagactaa

DBGET integrated database retrieval system