KEGG   Coxiella burnetii RSA 331: COXBURSA331_A2121
Entry
COXBURSA331_A2121 CDS       T00632                                 

Definition
(GenBank) conserved hypothetical protein TIGR00278
  KO
K08998  uncharacterized protein
Organism
cbs  Coxiella burnetii RSA 331
Brite
KEGG Orthology (KO) [BR:cbs00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    COXBURSA331_A2121
SSDB
Motif
Pfam: YidD
Other DBs
NCBI-ProteinID: ABX77310
UniProt: A9NBA4
Position
1928897..1929163
AA seq 88 aa
MYKQIVHAIGKAIQTLLLGLIKSYRYLISPVLMSSCRFYPSCSCYAETALKRFGVIKGSG
LTVWRLLRCHPFHPGGVDFVPEKSNEMV
NT seq 267 nt   +upstreamnt  +downstreamnt
atgtataaacaaattgttcacgcaattggaaaagcaatccaaacgctcctcctcggtttg
atcaaaagttatcgatatctgatcagtccagtgctaatgagttcttgtcgattttatcct
tcgtgttcttgttatgccgaaaccgctttaaagcggtttggtgtgataaagggtagtggt
ttaacggtttggcgcttactgcggtgtcatcccttccatcctggtggggttgattttgtg
cctgaaaagtccaatgagatggtgtaa

DBGET integrated database retrieval system