KEGG   Coxiella burnetii RSA 331: COXBURSA331_A2126
Entry
COXBURSA331_A2126 CDS       T00632                                 

Gene name
gidB
Definition
(GenBank) methyltransferase GidB
  KO
K03501  16S rRNA (guanine527-N7)-methyltransferase [EC:2.1.1.170]
Organism
cbs  Coxiella burnetii RSA 331
Brite
KEGG Orthology (KO) [BR:cbs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cbs03009]
    COXBURSA331_A2126 (gidB)
   03036 Chromosome and associated proteins [BR:cbs03036]
    COXBURSA331_A2126 (gidB)
Enzymes [BR:cbs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.170  16S rRNA (guanine527-N7)-methyltransferase
     COXBURSA331_A2126 (gidB)
Ribosome biogenesis [BR:cbs03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    COXBURSA331_A2126 (gidB)
Chromosome and associated proteins [BR:cbs03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    COXBURSA331_A2126 (gidB)
SSDB
Motif
Pfam: GidB Methyltransf_31 MTS Methyltransf_12 Methyltransf_25 Methyltransf_4 DUF2518 Methyltransf_16 Methyltransf_11
Other DBs
NCBI-ProteinID: ABX77374
UniProt: A9NBA9
Position
1934947..1935561
AA seq 204 aa
MTEKLKQGIDQLGLKVAETIQQSMLAFLAFLQKWNQAYNLTAITEIKSMITHHLLDSLSI
LPYLKGDKILDVGSGAGFPGIPLAFACPEKKFTLIDSKAKKTAFLLQAASRFKITNVTII
QERVGSYQPGFYFDTITCRALGSVREIMEQTNHLLRSGGQWLIMKGAYPEKELRGTDASA
IVHVLNVPGLKAERHLVEVKNNKG
NT seq 615 nt   +upstreamnt  +downstreamnt
atgacagaaaaactaaaacaaggcatcgaccaattggggcttaaggtcgcagaaactatc
caacaatcaatgctcgcctttctcgcttttctccaaaaatggaaccaggcttataacctc
accgccattaccgaaataaaaagcatgatcacccaccatcttttagacagcctatctatc
ctcccctatcttaagggcgataaaatcctcgatgtcggcagcggagccggcttccccggt
ataccattggctttcgcctgccccgaaaaaaaattcaccttgatcgatagcaaagctaaa
aaaacagcctttttgcttcaggcggcttctcgctttaagataaccaatgtcacgatcatt
caagagcgtgtgggctcttatcagccgggtttttattttgataccatcacgtgccgggca
ctgggaagcgttagggagatcatggaacaaaccaatcatttgctgcgttcgggcgggcaa
tggttgataatgaagggggcttatcctgaaaaagaattacgcggcacagacgcgtcggct
attgtgcacgttttaaatgtcccaggattaaaggcggagcgtcatcttgttgaagttaaa
aataataagggctag

DBGET integrated database retrieval system