KEGG   Clostridium botulinum E3: CLH_2339
Entry
CLH_2339          CDS       T00767                                 

Symbol
pflB
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
cbt  Clostridium botulinum E3
Pathway
cbt00620  Pyruvate metabolism
cbt00640  Propanoate metabolism
cbt00650  Butanoate metabolism
cbt01100  Metabolic pathways
cbt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLH_2339 (pflB)
   00640 Propanoate metabolism
    CLH_2339 (pflB)
   00650 Butanoate metabolism
    CLH_2339 (pflB)
Enzymes [BR:cbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     CLH_2339 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ACD53593
Position
complement(2509385..2511613)
AA seq 742 aa
MFKQWEGFKNGTWQEGIDVRNFIQKNYKVYEGDSSFLEGISEKTSRVWDKAYALIVEEVK
KGIIDIATDRVSGINNYEAGYIDKDNEVVVGLQTDAPLKRIVNPFGGFRMVQTSLKEYGY
ELDKDIEKHFSRYRKTHNEGVFDGYTKEIRLARTAGLLTGLPDAYGRGRIIGDYRRVALY
GIDYLIEEKKNDLDNLQGDMLDELVRKREEVSMQIRALGEIKEMAAKYGCDISKPASNAK
EAVQALYFGYLAGIKENNGAATSFGRTSTFLDIYIERDLEAGLITEKEAQELVDQLIIKL
RLVRHLRTPEYNDLFGGDPTWVTESIGGMGINGKSLVTKNSFRYLHTLINLGASAEPNLT
VLWSDKLPENFKKYCAEISIKTDAVQYESDEVMRPIYGDDYAIACCVSAMKVGKQMQFFG
ARCNIAKSLLYAINGGCDELKGMKVIPGIEVMNDEVLDFNKVKENYFKVLEYVAKIYVDT
MNIIHHMHDKYAYEAGQMALHDTMVDRLMAFGIAGLSVAIDSLSAIKYAKVKPIRNEEGL
AIDFEVEGDFPKYGNDDDRADDLGVELVTKFSNELKKHPLYRDAKHTLSALTITSNVMYG
KKTGTTPDGRKKGEPLAPGANPMHGRDANGALASLNSVAKIPYNEVCQDGVSNTFSIVPD
ALGKSEEQRISNLVSILDGYFVQGAHHLNVNVLNRETLIDAMENPDKYPTLTIRVSGYAV
NFSRLSKEQQLEVISRTFHESI
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgtttaaacaatgggaaggttttaaaaacggtacttggcaagaaggaattgatgtaaga
aactttatacaaaagaattataaggtgtatgaaggagattcaagcttcttagaaggtata
agtgaaaagacatcaagagtatgggacaaagcatacgcattaattgttgaagaagttaaa
aaaggaataatagatattgcaaccgacagagtttcaggaataaataactatgaagcagga
tatatagataaagacaatgaagtagttgtaggacttcaaactgatgctccacttaaaaga
attgtaaatccatttggtggatttagaatggtacaaacttcattaaaagaatatggatat
gaattagataaagatatagaaaaacatttttcaagatacagaaagactcacaatgaagga
gtttttgatggctatacaaaagaaataagacttgcaagaactgcaggacttttaacagga
cttccagatgcttatggtagaggaagaataataggtgattatagaagagtagctctttat
ggtatagattatttaatagaagaaaagaaaaatgatcttgataatcttcaaggggatatg
cttgatgaattagtaagaaaaagagaagaagtttctatgcaaattagagctttaggagaa
ataaaagaaatggcagctaaatatggctgtgatatatctaaaccagcatcaaatgctaaa
gaagctgtacaagctttatactttggatacctagctggaattaaagaaaataatggagca
gcaacttcatttggtagaacttcaactttcttagatatatatattgaaagagatttagaa
gcaggattaataactgaaaaagaagctcaagaattagtagatcaacttataataaaatta
agattagtaagacatctaagaactccagaatacaacgacttatttggtggagatccaaca
tgggtaactgaatcaattggtggaatgggtataaatggaaaatcgttagtaacaaagaac
tcatttagatatttacatacattaataaacttaggtgcttctgcagaaccgaatttaaca
gttttatggtcagataagttaccagaaaactttaaaaaatattgtgcagaaatatcaata
aagacagatgcagttcaatatgaaagtgatgaagtaatgagaccaatttatggtgatgac
tatgcaatagcttgttgtgtatcagctatgaaggttggtaaacaaatgcaattctttgga
gcaagatgtaatattgcaaaatcacttttatatgcaataaatggtggctgtgatgaatta
aaaggtatgaaagtaataccaggaattgaagtaatgaatgatgaagtcttagatttcaat
aaagtaaaagaaaattactttaaggttttagaatatgttgctaaaatttatgtagataca
atgaatataatacatcatatgcatgataaatatgcttatgaagcaggacaaatggcgtta
catgatactatggtagatagattaatggcatttggtattgcaggtctttcagttgcaata
gattcattatcagctattaaatatgcaaaagttaaaccaataagaaatgaagaaggacta
gctatcgactttgaagttgaaggagatttccctaaatacggaaatgatgatgatagagca
gatgatttaggagtagagttagtaactaagttctcaaatgaacttaagaaacatccttta
tatagagatgctaaacatacattatcagcacttacaattacatcaaatgttatgtatggt
aagaaaactggtacaacaccagatggaagaaagaaaggtgaacctttagcaccaggagct
aatccaatgcacggaagagatgcaaatggagcattagcatcattaaattcagttgctaaa
ataccttataatgaagtttgtcaagatggtgtttcaaatacattctcaattgtaccagat
gcacttggaaagagtgaagaacaaagaatatctaatttagtttcaattttagatggatac
tttgttcaaggagcacatcatttaaatgttaatgttcttaatagagagacattaatagat
gcaatggagaatccagacaagtatccaacattaacaattagagtttctggatatgccgtt
aacttcagtagactatcaaaagaacaacaattagaagttataagcagaacattccacgaa
agcatctag

DBGET integrated database retrieval system