KEGG   Clostridium botulinum E3: CLH_0046Help
Entry
CLH_0046          CDS       T00767                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cbt  Clostridium botulinum E3
Pathway
cbt00330  Arginine and proline metabolism
cbt00332  Carbapenem biosynthesis
cbt01100  Metabolic pathways
cbt01130  Biosynthesis of antibiotics
cbt01230  Biosynthesis of amino acids
Module
cbt_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CLH_0046 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CLH_0046 (proB)
Enzymes [BR:cbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CLH_0046 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PCI
Motif
Other DBs
NCBI-ProteinID: ACD53079
Position
51852..52661
Genome map
AA seq 269 aa AA seqDB search
MGFRKNLINANRIVVKVGTSTLTYDNGNINLRRIEKLTRVLSDIVNSGKEVVLVTSGAIG
VGVSKLKLKEKPESIREKQAVASVGQCELMHIYSKFFGEYSHVVGQVLLTRDVVEDDHIR
ENVCNTFETLMENKIIPIVNENDTVSIDEIENIVRFGDNDNLSAIVATLVKADLLIILSD
IDGFYDSDPRSNKDAKLLKVVEEITPELESCAGGAGSNLGTGGMVTKLTAAKTAVSAGVD
MILANGSDPSVILNVLDGEDVGTLFLGKK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggctttcgtaaaaatttaattaatgcaaatagaatagttgtaaaggtaggaacttca
acactaacatatgataacggtaatatcaacttaagaagaattgaaaagttaaccagagtt
ttatctgatattgttaattcaggaaaagaggttgttttagtaacatcaggtgctataggt
gttggtgtaagtaaattaaagttaaaagaaaagcccgaaagtataagagaaaaacaagca
gttgcatcagtaggacaatgtgaacttatgcatatatatagtaaattctttggtgaatat
agccacgttgttggtcaagttttacttactagagatgtagtagaagatgatcatattaga
gaaaacgtatgtaatacatttgaaacattaatggaaaataaaataattccaatagttaat
gaaaatgatacagtttcaatagatgagatagaaaatattgttaggtttggggacaatgat
aacttatcagctatagttgcaacattagtaaaggctgatttattaataatattatctgat
atagatggattttatgattctgatccaagaagcaataaggacgcaaaattattaaaagtt
gtagaagaaataacaccagaattagaaagttgtgctggaggcgctggttcaaatttagga
actggtggaatggtaacaaagcttacagctgctaaaacagcagtatctgcaggggtagat
atgattttagctaatggaagtgatccaagtgtaatattaaatgttttagatggtgaagat
gtgggaactttatttttaggtaaaaaataa

DBGET integrated database retrieval system