KEGG   Clostridium botulinum E3: CLH_0055Help
Entry
CLH_0055          CDS       T00767                                 

Gene name
carB
Definition
(GenBank) carbamoyl-phosphate synthase, large subunit
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
cbt  Clostridium botulinum E3
Pathway
cbt00240  Pyrimidine metabolism
cbt00250  Alanine, aspartate and glutamate metabolism
cbt01100  Metabolic pathways
Module
cbt_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:cbt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CLH_0055 (carB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLH_0055 (carB)
Enzymes [BR:cbt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     CLH_0055 (carB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 MGS Dala_Dala_lig_C ATPgrasp_Ter ATP-grasp ATP-grasp_3 GARS_A ATP-grasp_4 HTH_23 Ribosomal_L22e Usp
Motif
Other DBs
NCBI-ProteinID: ACD52312
UniProt: B2UX86
Position
61932..65141
Genome map
AA seq 1069 aa AA seqDB search
MPLNKDIKRVLVIGSGPIVIGQAAEFDYSGTQACEALKSEGVEVVLINSNPATIMTDKEV
ADKVYLEPLTLEFIEKVIAKEKPDSLLAGMGGQTGLNLAVELHDAGILDKYNVKVIGTSI
ESIKEGEDRELFRDMMNRIGEPVIKSEIVTDLQAGIDFANKIGYPVIVRPAYTLGGSGGG
IADDEEELRTILESGLQLSTIGQVLLEKSVKGWKEIEYEVMRDSYGNCITVCNMENIDPV
GIHTGDSIVVAPSQTLSDKEYQMLRTASINIINAVGIEGGCNVQFSLNPNTFEYAVIEIN
PRVSRSSALASKATGYPIAKLAAKIALGYGLDEIKNAVTQKTYACFEPTLDYVVVKIPKW
PFDKFFGADRQLGTKMMATGEIMAIGANFEQAFLKGIRSLEIGKYSLDHKKFKEHSMSEL
KDLVMKPDDERIFALAEMLRRDYMIERINKITGIDKFFLEKIKWIVEEEQRLKLSNIEDL
DKEWLKNLKKKGFSDKAIADMLKVSPEDIYRLRDIWSIKPSYKMVDTCGGEFEALSPYYY
STYEQYDEVEVSNRRKVIVIGSGPIRIGQGIEFDYASVHCVKALKKLDIETIIVNNNPET
VSTDFDISDKLYFEPLTEEDVLNIIEKENPYGVILQFGGQTAIKLANFLKEKNIKTLGTT
ADQIDMAEDREKFDELLERLDISRPKGKGIWSVEEGLEEAERLGFPVLVRPSYVIGGQGM
EITHDEEELTFYLTNAFAKDKKNPILIDKYLMGREIEVDAISDGENILIPGIMEHLERAG
VHSGDSVTMYPSQNVCDKIKGKILEYTKKLALAIGIKGMINIQFIEFEGSLYVIEVNPRA
SRTVPYISKVSGVPIVDIATQVMLGAKLNDLGYGVDIYKEPELISVKVPVFSTQKLPNVE
VCLGPEMRSTGEVLGVGRTLKEALYKGFVGANMYPSKEKGKILATINKHNKAEFLPIAKD
LAKVGYKFIATTGTCKLLRDEGIDAEEIRKIDEEKPNILDIVKNREVDLVVNTPTKGNDS
KRDGFLIRRAAVERNLGVITALDTLRAIADVELEEFDKNKDLEVFDITK
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgccattaaataaagatataaaaagagttttagttataggatcaggtccaatagttata
ggtcaagcagcagagtttgattattcaggaactcaagcctgtgaagctttaaaatcagag
ggagtagaggttgttttaataaattcaaacccagcaacaataatgactgataaagaagtt
gcagataaggtatacttagaaccgttaacattagaatttattgaaaaagttatagcaaaa
gagaaaccagatagtttacttgcgggaatgggtggtcaaacaggacttaaccttgctgta
gaattacacgatgctggtattttagataaatataatgtaaaagtaataggaacatctatt
gaatctataaaagaaggtgaagatagagaactatttagagatatgatgaacaggatagga
gaacccgttataaagagtgaaattgttactgatttacaagcaggtatagattttgctaat
aagattggatatccagttatagttagacctgcgtatacattaggtggatctggtggaggt
attgcagatgacgaagaagaattaagaacaatactagaatcaggtcttcaattaagtaca
ataggtcaagttttacttgaaaaaagtgttaagggttggaaagaaatagaatatgaagtt
atgagagattcttatggaaactgcattactgtatgtaatatggaaaatatagatcctgtt
ggaatacatacaggtgatagtatagttgttgcaccatcacaaactctttcggataaagaa
tatcaaatgcttaggacagcatctataaatataataaatgctgtaggtatagagggtgga
tgtaatgttcagttttcattaaatccaaatacttttgagtatgcagtaatagaaattaat
cctagagtttcaagaagttcagctttagcatcaaaagcaacaggttatccaattgcaaag
cttgcagctaaaattgcccttggatatggattagatgaaataaaaaatgctgtaactcaa
aaaacatatgcttgctttgaaccaacacttgattatgttgtagtgaaaataccaaaatgg
ccttttgacaaattctttggtgcagatagacagcttggaactaagatgatggctaccgga
gaaataatggccattggagctaactttgaacaagcatttttaaaaggaataagaagctta
gaaataggtaaatattctttagatcataaaaaatttaaagaacatagcatgtcagaactt
aaagatttggtaatgaaaccagatgatgaaagaatattcgctttagcagaaatgctaaga
cgtgattacatgattgaaagaataaataaaattactggaatagataaattcttcttagaa
aaaattaaatggatagttgaagaagaacaaagattaaaattaagtaatatagaagattta
gataaagaatggttaaagaacttaaagaaaaaaggtttttctgataaagcaatagcagat
atgttaaaggtaagtccagaagatatatatagattaagagatatctggagtataaaacct
tcgtataaaatggtagatacttgtggaggagaatttgaagcattatcaccatattactat
tctacttatgaacaatatgatgaagttgaagtatctaatagaagaaaagttatagtaata
ggatcaggtccaatccgaataggtcaaggaattgaatttgattatgcatcagttcattgt
gtaaaggcattaaagaaacttgatattgaaactataatagtaaataataatcctgaaact
gtaagtactgattttgatatatcagataagttatactttgaaccattaacagaagaagat
gttttaaacataattgaaaaagaaaatccatatggtgtaattcttcaatttggtggtcaa
acagcaataaagcttgctaatttcttaaaggaaaaaaatattaagactttaggaactaca
gcagatcaaatagatatggctgaagatagagaaaagtttgatgaactattagaaagatta
gacatatcaagacctaaaggtaaaggtatatggtcagtagaagaaggcttagaagaagct
gaaagattaggtttcccagtacttgttagaccttcttatgtaattggtggtcaaggaatg
gaaataactcatgatgaagaggagttaactttctacttaactaatgcatttgcaaaggac
aaaaagaatccaatacttatagataaatatttaatgggtagagaaattgaagtagatgca
atatcagatggggaaaatatacttataccaggaataatggaacatttagaaagagcagga
gttcactctggggatagtgtaactatgtatccaagtcaaaatgtttgtgataaaattaag
gggaaaatcttagaatatactaagaagttggctttagcaataggaataaaaggcatgata
aatattcaatttatagagtttgaaggaagtttatatgtaattgaagttaatccaagagca
tcaaggactgtaccttatataagtaaggttagtggagttccaatagttgatatagcaact
caagttatgctaggagccaaattaaatgatttaggatatggagtagatatatataaagaa
cctgaactaatttcagttaaagttccagtattctcaactcaaaaattaccaaatgttgaa
gtatgcttaggacctgaaatgagatcaacaggagaagttttaggagtgggtagaacttta
aaagaagctctttataaaggatttgtaggggcgaatatgtatccatcaaaggaaaaaggt
aaaatactagcaacaataaataagcataataaagcagaatttttaccaatagccaaggat
cttgctaaagttggatataagtttatagcaacaacaggaacatgcaagctattaagagat
gaaggaatagatgcagaagaaattcgtaagatagatgaagaaaagcctaatattttagat
atagttaaaaatagagaagttgatttagttgtcaatactccaactaagggtaatgactct
aagagagatggtttcttaattagaagagcagctgttgaaagaaatttaggggttattact
gcattagacacattaagagcaattgcagatgtagaattagaagaatttgataaaaataag
gatttagaagtatttgatataactaaataa

DBGET integrated database retrieval system