KEGG   Clostridium botulinum E3: CLH_0166Help
Entry
CLH_0166          CDS       T00767                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
cbt  Clostridium botulinum E3
Pathway
cbt00670  One carbon pool by folate
cbt01100  Metabolic pathways
cbt01120  Microbial metabolism in diverse environments
cbt01200  Carbon metabolism
Module
cbt_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cbt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CLH_0166 (fhs)
Enzymes [BR:cbt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CLH_0166 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ACD51878
UniProt: B2UXU5
Position
185252..186922
Genome map
AA seq 556 aa AA seqDB search
MKTDIEIAQEAEMLHIRNIAEKLGLDEEDIEYYGKYKCKISLDVYNKVKNNRDGKLVLVT
AINPTPAGEGKSTVTVGLGDALNKMGKNTVIALREPSLGPVFGIKGGAAGGGYAQVVPME
DINLHFTGDMHAITSANNLLSAAIDNHIHQGNNLRIDSRRIIFKRVMDMNDRALRKIIVG
MGGKINGFVREDGFTITVASEIMAILCLASDLEDLKHRMGDILIAYDLDGNPVYAKQLEI
QGAMALLMKDAIKPNLVQTLENTPALIHGGPFANIAHGCNSIMATKLSLKLGDIVVTEAG
FGADLGAEKFFDIKCRYGNLKPCCVVIVATIRALKHHGGVAKADLNIPNVEALRLGIANL
EKQIENIKKFNVEPVVAINKFVSDSDEEVEFIKEFCEKLGVKVALSDVWAKGGDGGIELG
EAVLDVIEKDKSSFKTLYKADNTIEEKILTIAKEIYGADGVVYSNEAKKQIGELVKFNLD
KLPICMAKTQYSLSDNPNLLAKPSGFNINVQEIRVSNGAGFIVVQTGNIMTMPGLPKVPA
ANKMDVLKDGEIVGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgatatagaaattgcacaagaagcagaaatgttacatattagaaatattgca
gagaagttaggcttagatgaagaggatattgagtactatggtaaatataaatgtaagatt
tctttagatgtatataataaagttaaaaacaatagagatggaaagttagtattagtaaca
gctataaatccaactccagcaggagaagggaaatcgactgttacagtaggtttaggagat
gctcttaataagatgggtaaaaacactgttatagcattaagagaaccctcattagggcca
gtatttggtataaagggaggtgctgctggtggtggatatgcacaagtagttcctatggaa
gatattaaccttcattttacaggtgatatgcacgctattacatctgctaataatttatta
tcagcagcgatagataatcatatacatcaaggtaataatttgagaatagactcaagaaga
ataatattcaaaagagttatggatatgaatgatagagctttaagaaaaatcattgttggt
atgggtggaaaaatcaatggtttcgtaagagaagatggttttacaataactgttgcttca
gaaataatggctatactttgtttagctagtgatttagaagatttaaagcatagaatggga
gatatactaatagcgtatgatttagatggaaatcctgtatatgcaaaacagttagaaatt
cagggggctatggcattattaatgaaagatgcgattaaacctaatttggttcaaacatta
gaaaacactccagcattaatacatggaggaccttttgcaaatatagcacatggatgtaat
tctataatggctactaagttatcacttaaattaggggatattgtagttactgaagcaggt
tttggtgctgatttaggcgctgaaaagttttttgatataaaatgtagatatggaaactta
aagccttgctgtgtagttatagttgctacaattagagcgttgaagcatcacggtggagtt
gctaaagctgatttaaatattccaaatgttgaagctttaagattaggaatagctaattta
gaaaaacaaatagaaaatattaaaaaattcaatgtagaaccagtagtagctataaataaa
tttgttagtgatagtgatgaagaagttgaatttataaaagaattttgtgaaaaattaggt
gtaaaagtagctctttctgatgtatgggcaaaaggtggagatggcggaatcgaattaggt
gaagctgtattagatgttatagaaaaagataaatctagttttaaaactctttataaggct
gataacactatagaagaaaagatattaactatagcaaaggaaatctatggagctgatgga
gttgtatatagtaatgaagcaaaaaaacagattggtgaattagttaaatttaatttagat
aaattacctatatgtatggcgaaaactcaatattcattatcagataatccgaatttatta
gctaaaccaagtgggtttaatattaatgttcaagaaattagagtgtctaatggagcagga
tttatagtagttcaaacaggcaatataatgactatgccgggattaccaaaagttccagct
gcaaataagatggatgtacttaaagatggagaaatagttggactattttaa

DBGET integrated database retrieval system