KEGG   Clostridium botulinum E3: CLH_0482Help
Entry
CLH_0482          CDS       T00767                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbt  Clostridium botulinum E3
Pathway
cbt00071  Fatty acid degradation
cbt00072  Synthesis and degradation of ketone bodies
cbt00280  Valine, leucine and isoleucine degradation
cbt00310  Lysine degradation
cbt00362  Benzoate degradation
cbt00380  Tryptophan metabolism
cbt00620  Pyruvate metabolism
cbt00630  Glyoxylate and dicarboxylate metabolism
cbt00640  Propanoate metabolism
cbt00650  Butanoate metabolism
cbt00900  Terpenoid backbone biosynthesis
cbt01100  Metabolic pathways
cbt01110  Biosynthesis of secondary metabolites
cbt01120  Microbial metabolism in diverse environments
cbt01130  Biosynthesis of antibiotics
cbt01200  Carbon metabolism
cbt01212  Fatty acid metabolism
cbt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLH_0482
   00630 Glyoxylate and dicarboxylate metabolism
    CLH_0482
   00640 Propanoate metabolism
    CLH_0482
   00650 Butanoate metabolism
    CLH_0482
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLH_0482
   00072 Synthesis and degradation of ketone bodies
    CLH_0482
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLH_0482
   00310 Lysine degradation
    CLH_0482
   00380 Tryptophan metabolism
    CLH_0482
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLH_0482
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLH_0482
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLH_0482
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbt04147]
    CLH_0482
Enzymes [BR:cbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLH_0482
Exosome [BR:cbt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLH_0482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C SpoVAD ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACD52338
Position
485874..487055
Genome map
AA seq 393 aa AA seqDB search
MKEVVIVSAVRTALGSFGGALKTVPAVDLGATVIKEALNRAGVKPEAVEEVIMGNVIQAG
LGQNPARQSTLKAGLPNEVPAMTINKVCGSGLRAVSLAAQMIKAGDADVIVAGGMENMSA
APYVLPGARWGQRMGDAKMVDTMIKDGLWDAFNNYHMGVTAENIAKQWGLTREEQDAFSA
GSQQKAQKAIESGRFKDEIVPVMIPQRKGEPKVFDTDEFPRFGTTKESLGKLKPAFIKDG
TVTAGNASGINDGAAAFVVMSAEKAAELGVKPLAKILSYGSKGLDPAIMGYGPFHATKKA
LEEANLTIADLDLVEANEAFAAQSLAVAKDLGFDMEKVNVNGGAIALGHPVGASGARILV
TLLHEMEKRDAKKGLATLCIGGGMGTALIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttattgtaagtgcagtaagaacagctcttggaagctttggtggagca
ttaaaaactgttccagcagtagatttaggagcaactgtaattaaagaagcattaaacaga
gcaggtgttaaaccagaagctgttgaagaagttataatgggtaatgttatacaagctggt
ttaggacaaaatccagctagacaatcaactttaaaagcaggtttacctaatgaagttcct
gctatgacaattaataaagtttgtggttctggattaagagcagttagtttagcagctcaa
atgataaaagcaggagacgcagatgttatagttgctggtggtatggaaaacatgtcagct
gcaccatatgtattaccaggtgctagatggggccaaagaatgggcgacgctaaaatggtt
gatactatgattaaagatggattatgggatgcatttaacaactatcatatgggtgttact
gctgaaaatattgcaaaacaatggggattaactagagaagaacaagatgctttctcagct
ggatctcaacaaaaagctcaaaaagcaattgaaagtggaagatttaaagatgaaatagtt
ccagttatgattccacaaagaaagggagaaccaaaagtatttgatactgatgaattccca
agatttggaacaactaaagagtctttaggtaaattaaaaccagctttcattaaagatgga
acagttacagcaggtaatgcttcaggaataaatgatggagcagcagctttcgttgttatg
agtgctgaaaaagcagctgaattaggagttaaaccattagctaaaatactttcttatgga
tcaaaaggattagatccagctataatgggatacggaccattccatgcaactaagaaagct
ttagaagaagctaacttaactattgctgatttagatttagtagaagctaatgaagctttt
gcagctcaaagtttagcagttgctaaagatttaggatttgatatggaaaaagttaatgtt
aatggaggagctattgcattaggacatccagttggagcatctggtgctagaattcttgtt
acattacttcatgaaatggaaaaaagagatgctaaaaaaggtttagcaacactttgtata
ggtggaggaatgggaactgctcttatagttgaaagactataa

DBGET integrated database retrieval system