KEGG   Clostridium botulinum E3: CLH_0599
Entry
CLH_0599          CDS       T00767                                 

Definition
(GenBank) putative xanthine dehydrogenase, iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
cbt  Clostridium botulinum E3
Pathway
cbt00230  Purine metabolism
cbt01100  Metabolic pathways
cbt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLH_0599
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ACD52249
Position
605807..606280
AA seq 157 aa
MSNTKMKKISMTVNDKSYELEVDIRESLLDVLRNKIHCTGVKCGCHVGECGACTVLIDGV
PTDSCIYMAVWANGKSIVTIEGVKKDGKLSKVQQAFIDEGAVQCGFCTPGLVLTSTALVN
SGKKYTDAEIKREISGHLCRCTGYQKIFNATKKSLQK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgagtaatacaaaaatgaaaaaaatatcaatgacagtaaatgataaatcttacgaatta
gaagttgatataagagaatctttacttgacgttttaagaaataaaatacattgtacaggt
gtaaagtgtgggtgtcatgttggagagtgtggagcttgcactgtactaatagatggagtt
cctactgattcttgtatatatatggcagtatgggcaaatggaaagagtatcgtaacaatt
gaaggggttaagaaagatggtaaattatcaaaagttcaacaagcttttattgatgaaggt
gctgttcaatgtggattttgtacaccaggactagtattaacatctacagctcttgttaat
agtggaaaaaaatatactgatgctgagataaaaagagaaatttcaggacacttatgtcgt
tgtacagggtatcaaaagatatttaatgcaactaagaaatctttacaaaaataa

DBGET integrated database retrieval system