KEGG   Clostridium botulinum E3: CLH_1782Help
Entry
CLH_1782          CDS       T00767                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
cbt  Clostridium botulinum E3
Brite
KEGG Orthology (KO) [BR:cbt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CLH_1782
Enzymes [BR:cbt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     CLH_1782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP_C PHP
Motif
Other DBs
NCBI-ProteinID: ACD53668
Position
complement(1911928..1912701)
Genome map
AA seq 257 aa AA seqDB search
MNIDFHVHSILSKKLNFDPELFLLGIEYAKENGLDGFILCEHFNAVDLLSSYSYLESNYE
YDGDRYIVNGFSVFIGMEVDIRYGGHVIVSGNRNSILKIRTALEPYVKKFNFIPFGKLLD
LGEKYECLIIGSHPYRENHKLYLQPKKYLERLDALDLNTKDIYKRGLEIVEDEVANLSKI
LNIPYVTGSDSHYPVQLGTVKTCFESECHTIKELKECIKNKKYKIEISKALKLKVYTSKI
TKNYLKKQIKLSKQSCK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagatttccatgtacacagcattcttagtaaaaaacttaattttgaccctgaa
ttatttttattaggaatagaatatgcaaaagaaaatggtttagatggttttatattgtgt
gaacactttaatgcagtagatttgttatcatcatattcgtatctagaaagtaattatgaa
tatgatggcgatagatatattgttaatggtttttctgtttttattggtatggaagtagat
ataagatatggtgggcatgttatagtatcgggaaacaggaattctatattaaaaatcaga
actgcgcttgaaccttatgttaaaaaatttaattttattccttttggaaaattactagat
ttaggtgaaaaatatgaatgcttaatcatagggagccatccttatagagaaaatcacaaa
ttatacttacaacctaaaaagtatttagaaagattagatgcactagatttaaatacaaaa
gatatttataaaagaggtcttgagattgtagaagatgaagtagcaaatttatcaaaaatt
ttaaatataccttatgtaacaggaagtgatagtcattatccagtacaacttggtactgta
aagacatgctttgaaagtgaatgtcatacaataaaagaattaaaggaatgcattaaaaat
aaaaaatataaaatagagatatctaaagctttgaaattaaaagtatacacttctaaaata
acaaaaaattatttaaaaaagcagataaagttatcaaaacaaagttgtaaataa

DBGET integrated database retrieval system