KEGG   Clostridium botulinum E3: CLH_1814Help
Entry
CLH_1814          CDS       T00767                                 

Definition
(GenBank) acyl-coa dehydrogenase, short-chain specific
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
cbt  Clostridium botulinum E3
Pathway
cbt00071  Fatty acid degradation
cbt00280  Valine, leucine and isoleucine degradation
cbt00410  beta-Alanine metabolism
cbt00640  Propanoate metabolism
cbt00650  Butanoate metabolism
cbt01100  Metabolic pathways
cbt01110  Biosynthesis of secondary metabolites
cbt01120  Microbial metabolism in diverse environments
cbt01130  Biosynthesis of antibiotics
cbt01200  Carbon metabolism
cbt01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CLH_1814
   00650 Butanoate metabolism
    CLH_1814
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLH_1814
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLH_1814
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLH_1814
Enzymes [BR:cbt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     CLH_1814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: ACD51069
Position
complement(1943382..1944521)
Genome map
AA seq 379 aa AA seqDB search
MDFTLTKQQEMIKEMARQFAENELKPRVLENDENSEFPIEAYKKLGKLGFIGIPYPKEYG
GAGGDYLSYVLAVEEISKVDASFGISYSVTTSLCSGGIINAASEEQKKKYLPDVLSGKKL
GSFGLTEPNAGSDAGGCITTAEKKGDYYILNGSKCFITNGPLSETFLVFALTDKSKGSKG
LSAFIVEKEFEGFSIGKIENKCGIKSAQVSELIFENCKVPAENLVGAEGKGFGIAMKALD
GGRIGVAAQGLGIAEGAFDIVKQYLKDRQQFGKPLWKNQYLAFKMAELELEIEKAKYILY
KAAMDKQEGRTYSVSAAKAKLSCTDVAMKVTVEAVQMLGGNGYMKEYNVERMMRDAKITQ
IYEGTNEIQKLIISGSIFR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggactttactttaacaaaacaacaagaaatgattaaagaaatggcaagacaatttgca
gaaaatgaacttaaaccaagggtacttgaaaatgatgaaaatagtgagtttccaattgaa
gcatataagaaattaggaaagttaggctttataggaataccgtatccaaaagagtatggt
ggagctggtggagattacttatcttatgttctagcagtggaagaaatttctaaagttgat
gcttcatttggtatatcatattcagtaactacatcactttgctcaggtggaattattaat
gctgcatctgaagagcaaaagaaaaaatatcttcctgatgtactttcagggaaaaaactt
ggttctttcggattaactgaaccaaatgcaggatctgatgctggtggatgcataactaca
gcagagaaaaaaggagattattatatattaaatgggagcaagtgttttataactaatggc
ccgttatcagaaacatttttagtatttgcattaactgataagagtaagggttcaaaagga
ctatcagcatttatagttgaaaaagaatttgaaggattttcaataggtaaaatagaaaat
aaatgcggtataaaatcagcacaagtttcagagcttatatttgaaaattgtaaggtacca
gcagaaaatttagttggtgctgagggaaaaggctttggaattgccatgaaagctcttgat
ggtggcagaatcggtgttgcagctcaaggacttggaatagcagaaggtgcttttgatata
gtgaaacaatacttaaaagatagacaacaatttggaaagcctttatggaaaaatcaatat
ttagcatttaaaatggcagaattagagcttgaaattgaaaaagctaaatatattttgtat
aaggcagctatggataaacaagaaggaagaacatattcagtttcagcagctaaagctaaa
ctatcttgtactgatgttgctatgaaagttacagttgaagctgttcaaatgttgggtgga
aatggttatatgaaggaatacaatgttgaaagaatgatgagagatgctaagattactcaa
atatatgaaggaacaaatgaaatacaaaaactaattataagtggaagcatatttagataa

DBGET integrated database retrieval system