KEGG   Clostridium botulinum E3: CLH_2885Help
Entry
CLH_2885          CDS       T00767                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
cbt  Clostridium botulinum E3
Pathway
cbt00520  Amino sugar and nucleotide sugar metabolism
cbt01100  Metabolic pathways
cbt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CLH_2885 (nagA)
Enzymes [BR:cbt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     CLH_2885 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ACD51240
Position
3058847..3059986
Genome map
AA seq 379 aa AA seqDB search
MLITNCNIIYLDKIEKGSVIIQDGKIKKINPSNFTNNEINQIIDAKGLYLSPGFIDAHIH
GAGGCDTMDGTIDSINTIAKTIAKHGTTSFVPTTMTVSISDINKSMRVIKLLKEKGSKGA
HVLGAHLEGPFINSNAIGAQNPNYILPPSISTYKSMVKDCEDSVISLTLAPELDGSKDLI
KYLSNKGIICSLGHTKATYEETIDAIKCGATHSTHLYNAMPSFTHRNPGIIGAIFDSDIK
TETISDGIHISYPALRIAYKQKGTDNVLLITDAMMACCMPDGKYKLGGQDVIVKNGAARV
KSGSLAGSILTLNKAIKNIYKNSDLPLNEIVKMASYNPAKHCKVDNHKGLIKEGYDADLV
LFDDNINIKKVFISGKEFY
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgttaattacaaattgcaacattatttatttagataaaatagaaaaaggttctgttatt
attcaagatggtaaaataaaaaaaattaatccgtctaattttactaataatgagattaat
caaattatagatgcaaaaggtttatacctttcacctggatttatagatgcacatattcat
ggtgctggtggatgtgatactatggatggaacaatagattctataaatacaattgcaaaa
acaatagccaagcatggtacaacatcctttgttcctactactatgacagtttcaattagt
gatattaataagtctatgagagttattaaattattaaaagaaaaaggttcaaaaggtgct
catgttttaggagctcatttagaaggtccttttataaattcaaatgcaattggtgctcaa
aatcctaattacattttgccaccatcaatatcaacttataaatctatggttaaggattgt
gaggactctgttatctcacttacattggcaccagaacttgatggctctaaagatttaatt
aaatatctttctaacaaaggaattatctgttcattaggccatacaaaagctacttatgaa
gaaacaatagatgcaataaaatgtggtgctactcattcaactcacctttataatgcaatg
ccttcctttactcacagaaatccggggattataggcgctatatttgatagtgatataaaa
acagaaactatttcagatggaattcatatctcatatcctgcattgagaattgcttataag
caaaaaggtacagataatgttttgttaataactgatgctatgatggcatgttgtatgcct
gatggaaaatataaattaggtgggcaagatgttatagttaaaaatggcgcagcaagagtt
aagtctggatctttagcaggttcaatactaacccttaataaagctattaaaaatatttat
aaaaattcagatttgcctttaaatgaaattgtaaaaatggcttcatataatccagctaaa
cattgtaaggtagataatcataagggattaattaaagaaggttacgatgctgatttagta
ttatttgatgataatataaacataaaaaaagtatttatttcaggaaaagaattttattaa

DBGET integrated database retrieval system