KEGG   Coxiella burnetii RSA 493: CBU_0243Help
Entry
CBU_0243          CDS       T00124                                 

Gene name
rplV
Definition
(RefSeq) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cbu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CBU_0243 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cbu03011]
    CBU_0243 (rplV)
Ribosome [BR:cbu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CBU_0243 (rplV)
  Bacteria
    CBU_0243 (rplV)
  Archaea
    CBU_0243 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 1208124
NCBI-ProteinID: NP_819287
UniProt: O85387
Position
227838..228185
Genome map
AA seq 115 aa AA seqDB search
MEVAAKLKYARISAQKARLVADQVRGLGAEQAVNLLRFSNKKAAALMKKVLDSAIANAEH
NEGADIDELKVSTVMVDEGPSARRFHARARGRANQILKRTCHITVKVSDSQVEND
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggcagcaaagttaaaatacgcgcgaatatcagcgcaaaaagcaagattggta
gccgaccaagttcgaggactgggagcggaacaggctgttaatttgctgcgctttagtaat
aaaaaagcggccgctttgatgaaaaaagtgttggattcggccatcgcaaatgcagagcat
aacgagggcgctgacattgatgaattaaaagtatcgaccgtaatggtggatgaggggccc
tcagcgcgacgatttcatgcgcgagctcgaggtcgtgcaaaccaaattttgaaacgcacc
tgccacatcacggtgaaggtgtcggattcgcaagtggagaacgactaa

DBGET integrated database retrieval system