KEGG   Coxiella burnetii RSA 493: CBU_0576Help
Entry
CBU_0576          CDS       T00124                                 

Gene name
yfcX
Definition
(RefSeq) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00071  Fatty acid degradation
cbu00280  Valine, leucine and isoleucine degradation
cbu00281  Geraniol degradation
cbu00310  Lysine degradation
cbu00362  Benzoate degradation
cbu00380  Tryptophan metabolism
cbu00410  beta-Alanine metabolism
cbu00640  Propanoate metabolism
cbu00650  Butanoate metabolism
cbu00903  Limonene and pinene degradation
cbu00930  Caprolactam degradation
cbu01040  Biosynthesis of unsaturated fatty acids
cbu01100  Metabolic pathways
cbu01110  Biosynthesis of secondary metabolites
cbu01120  Microbial metabolism in diverse environments
cbu01130  Biosynthesis of antibiotics
cbu01200  Carbon metabolism
cbu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CBU_0576 (yfcX)
   00650 Butanoate metabolism
    CBU_0576 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    CBU_0576 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    CBU_0576 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBU_0576 (yfcX)
   00310 Lysine degradation
    CBU_0576 (yfcX)
   00380 Tryptophan metabolism
    CBU_0576 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CBU_0576 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CBU_0576 (yfcX)
   00281 Geraniol degradation
    CBU_0576 (yfcX)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBU_0576 (yfcX)
   00930 Caprolactam degradation
    CBU_0576 (yfcX)
Enzymes [BR:cbu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CBU_0576 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CBU_0576 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CBU_0576 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 NAD_Gly3P_dh_N ApbA AlaDh_PNT_C Pyr_redox_2 Methyltransf_12 DLH Gmx_para_CXXCG
Motif
Other DBs
NCBI-GeneID: 1208461
NCBI-ProteinID: NP_819606
UniProt: Q83DW6
Position
527564..529615
Genome map
AA seq 683 aa AA seqDB search
MKWQRGSKMRELQTYKHWKIKTDKDGILWLTLDREDTSVNSMNREVFTEFNKVLDEIAAQ
NPIAVILQSGKKKGFIAGADIKQFTDLKNKNEAFDLIRQAQLVLDKLEALPMPTVAMISG
FCLGGGLEVALACRYRVAEDNESTLIGLPEVKLGIHPGWGGTVRLSKLIGAPKAMEIMLP
GAAVPARKSAKLGMVDAAVPLRNLENAARYFALQKPPVHKPKGWEKYTNVSYIRPWLGRL
FYKKLSAKVEKTHYLAPYAIVHNWIKEGVGKEAYFTEAQSIAQLMMTESSRNMVRLFFLR
ERLKSLAKKTRYLPQQIHVIGAGVMGGDIAAWCALRGIRVTLHDKSAEKIAPAIKRAHAL
YEKKLKIPRLIQAAMDRLEPDVEGTGVKKADLIIEAVFEDIKVKQEVLSAIEPQLKPEAI
LATNTSSLSLDELSSVLKNPERLVAIHFFNPVAKLPLVEVASSQQTSADIAEKALAFVGA
IDKLPLAVSSSPGFLVNRALMAYLLEANRCLDEGFSMEQIDKAATDFGMPIGPIELADRI
GLDICLSVAQHLKNFYKHAEVSERLKTLVKEGHLGAKTGQGFYHYQNGRRVESKSTAEST
NPDLTDRLILQLVNEVKKCLDEKVIDKEDLADAGIVFGTGFAPFRGGPMQYAKSRGEADV
VKTLKRLAKQYGERFLPSEGWSA
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatggcagcgagggagtaaaatgcgggaattacaaacttacaaacactggaaaata
aaaaccgataaagatggtattctttggttaaccctcgaccgtgaagatacatcggtaaat
tcaatgaatcgggaagtttttactgaatttaataaagtgctcgatgaaattgctgctcaa
aatcccatagccgttatccttcaatcaggaaagaaaaaaggattcatcgccggtgcagac
atcaaacaatttaccgatttaaaaaacaaaaatgaagcctttgatttaatccgccaagcg
cagctcgtccttgataagctcgaagcgctgcccatgccaaccgtagcgatgattagcgga
ttttgtttaggcggcggtttggaagtggcgcttgcctgtcgctatcgagtggcggaagat
aatgaatccacgctgattggattacccgaagtgaaattgggtattcatccagggtggggt
ggtaccgttcgattgtctaaattaatcggcgcgccgaaagcaatggaaattatgctgcca
ggtgcagcagttccggcgagaaaatctgctaagcttgggatggttgacgccgcagtaccg
cttcgtaatttagaaaatgccgctcgttatttcgctttgcaaaagccccccgtccataaa
ccgaaaggatgggaaaaatacacgaatgtaagttatattcgcccgtggttagggcggtta
ttttataaaaaactctctgcaaaagtggaaaaaacgcattacctggcgccatacgccatc
gtccataattggatcaaagagggggttggcaaagaagcctacttcacagaagctcagtcg
atcgcgcaattaatgatgaccgagagcagtcgcaacatggtgcgactgttttttttaaga
gaacgcttgaagtcgctcgctaaaaaaacgcgctatctgccgcaacaaattcacgttatt
ggcgctggtgtgatgggcggcgatattgcagcttggtgtgcgcttcgcggcatccgcgtg
actttacacgataaatcagcggaaaaaattgcgccggcgataaagcgggcgcatgctctt
tatgaaaaaaaattaaaaatcccgcgcttaattcaggcagcgatggaccgattagagccg
gatgtggaaggaacgggcgttaaaaaagcggatttaattattgaagctgtttttgaggat
ataaaagtaaagcaggaagttttaagtgctatcgaaccgcaattaaaacccgaggctatt
ttagcgactaacacgtccagtctttctttagatgaattaagttcggtgttaaaaaaccct
gagcgcttagtggctattcattttttcaatcccgttgctaaattaccgttggttgaagtg
gcaagcagtcagcagacatcggcggacattgctgaaaaagcgttagcgttcgtgggagct
attgataaattgccgttggcggtgagcagcagtccaggatttttagtcaatcgggcatta
atggcttatttattagaagcgaaccgttgtttagacgaagggttttccatggaacaaatt
gataaagcggcaactgattttgggatgcccataggtccgatcgagctagctgatcggatt
gggttagacatatgtttgtctgttgctcaacatctgaaaaacttttacaagcatgccgaa
gtttcagaacgattaaaaacattggttaaggaaggtcatctaggcgctaaaacgggtcaa
gggttttatcattatcaaaacggaagacgtgttgaatcaaagtctacagccgaatcaacg
aatcctgatttaaccgaccggttaatattgcaactcgttaatgaagtcaagaaatgtttg
gatgagaaagtgattgacaaggaagatttagccgatgcagggatcgtatttggcacgggg
tttgcaccgtttcggggtggaccgatgcagtatgccaagagtcgtggagaggccgatgtc
gtgaaaactttaaaacgcttagcaaaacaatacggtgaacgatttttgcctagcgaagga
tggtccgcatga

DBGET integrated database retrieval system