KEGG   Coxiella burnetii RSA 493: CBU_0638Help
Entry
CBU_0638          CDS       T00124                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00010  Glycolysis / Gluconeogenesis
cbu00020  Citrate cycle (TCA cycle)
cbu00620  Pyruvate metabolism
cbu01100  Metabolic pathways
cbu01110  Biosynthesis of secondary metabolites
cbu01120  Microbial metabolism in diverse environments
cbu01130  Biosynthesis of antibiotics
cbu01200  Carbon metabolism
Module
cbu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBU_0638
   00020 Citrate cycle (TCA cycle)
    CBU_0638
   00620 Pyruvate metabolism
    CBU_0638
Enzymes [BR:cbu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CBU_0638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 1208523
NCBI-ProteinID: NP_819668
UniProt: Q83DQ8
Position
complement(586914..588050)
Genome map
AA seq 378 aa AA seqDB search
MKVFKLPDLGEGLPDATIREWYIAVGDEVKIDQPLVAMETAKALVDVPSPLAGKIEKLFG
EVGDVIETGSPLIGFEGEAETEEPKDTGTVVGAIETSDTVLEESGAGIPVKKAAEKKNFK
ATPAVRMLAKQLGVDLTKITPKSSLISAEEVKQAAQITKTGKTQKIEGELTPLSPVRRAM
AQSMSQSHREVVPVSLMDDGDLSAWKGEQDITLRIIRAIEAACQAVPIMNAHFDGETLGY
KLNETINIGIAVDTPQGLYVPVLKDVSHQDDTALRNQINRFKELAQSRSFPPEDLRDATI
MLSNFGAFAGRYANPILLPPMVTIIGVGRTRDEIVPVDGKPAVHRILPLSVTSDHRVITG
GEIARFLKQLIDSLEKAS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttttaaattacctgatcttggagagggattgcccgatgccaccattcgagaa
tggtatatcgccgtgggagatgaagtgaagatcgaccagcctttagtggctatggaaaca
gcaaaagcattggtggacgtcccctctcccctggctggcaagatcgaaaagttatttggt
gaagttggcgatgttattgaaacgggaagtcccttgattggatttgaaggcgaagctgaa
accgaagaacctaaagataccggcactgtcgttggagctattgaaacaagcgacactgtt
ttggaggaatcaggcgcgggtatccccgttaaaaaagcggctgagaaaaaaaattttaaa
gccacacccgccgttcgtatgttagccaaacaattgggcgttgatcttaccaagatcaca
cctaaaagctccctaatttctgccgaagaagtcaagcaagccgcccaaattaccaaaacg
ggtaagacccaaaaaattgaaggagaactaacaccgttatctcccgtacgccgggccatg
gcccaaagcatgtctcaatcccatcgagaggtcgttcccgtgagcttaatggatgacggc
gatttatctgcttggaaaggcgaacaagatatcactctgcggattatccgcgcaatcgaa
gcggcttgccaagcagtgcccattatgaacgctcatttcgatggtgaaactctgggttat
aaactgaatgaaacgattaatattggaatagccgtggatactcctcaaggactgtatgtt
cccgtattaaaagatgtcagccatcaggatgacacggcgcttcgcaaccaaattaatcgc
ttcaaagaactcgctcaaagccgcagcttcccgccggaagatctgcgcgacgctacgatc
atgctttctaattttggcgcttttgcgggacgttatgccaatcctattctcttgccacct
atggtgaccattatcggtgttggccgcacccgggatgaaatcgtgcctgttgatggcaaa
cccgctgtccatcggatattgccgctttcagtaacaagcgatcatcgagtaattaccggg
ggcgaaatcgcccggtttttgaagcagctaattgattcgctcgaaaaagcttcctga

DBGET integrated database retrieval system