KEGG   Coxiella burnetii RSA 493: CBU_0954Help
Entry
CBU_0954          CDS       T00124                                 

Definition
(RefSeq) MutT/nudix family phosphohydrolase
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00760  Nicotinate and nicotinamide metabolism
cbu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CBU_0954
Enzymes [BR:cbu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     CBU_0954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX-like zf-NADH-PPase DZR AOC_like FAM35_C ASFV_p27
Motif
Other DBs
NCBI-GeneID: 1208849
NCBI-ProteinID: NP_819963
UniProt: Q83CZ6
Position
complement(904692..905438)
Genome map
AA seq 248 aa AA seqDB search
MKKLRLLFFANQLLVVKRKNFCELPAFDDWPEWVGDLKYPHNLGVYNNCYCYAAEVDEQF
DKDENYVWMSLRSAVENIDQKWFSVAARAYQIINWDKNHRYCGRCGQETKKNSNIFERQC
LSCNLFFYPKISPSIIVLIRKANKILLARKSEFPAGVYGLIAGFVEPGESLEEALHREVA
EEVGISIKNIHYFGSQPWPFPDSLMLAFIADYAGGEIELNDGELESAGWYDANHLPGLPS
SASCSTTG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattgcggctattattttttgctaatcaactgttagtagtaaaacggaaaaat
ttttgtgaacttcctgcctttgatgattggccagaatgggtaggagatcttaagtatcct
cacaatctaggtgtgtataacaattgttattgttatgcggccgaagttgacgaacaattt
gataaggatgaaaattatgtgtggatgtccttaagatcggcggttgaaaatatcgatcaa
aaatggtttagcgttgccgctcgtgcttatcaaattattaattgggacaaaaatcaccgt
tattgcggtcgatgtggacaggaaacgaagaaaaattcaaatatatttgaacgccaatgc
ctttcctgcaatttatttttttacccgaaaatatcaccttctattatcgtgttaattcgc
aaagcgaataaaatacttttggcacggaaatcagaatttccagcgggagtttatggccta
atcgccggtttcgttgaaccgggtgaaagccttgaagaagcactgcatcgtgaggttgca
gaagaagtgggtatttctataaaaaatattcattactttggttctcaaccttggcctttt
ccggactctttaatgctagcgtttatcgctgactatgccggcggcgagatagaattaaat
gatggtgaattggaatccgcaggatggtacgatgcgaatcatctgccgggactcccatct
tcagccagttgctcgacaactggttga

DBGET integrated database retrieval system