KEGG   Coxiella burnetii RSA 493: CBU_0974Help
Entry
CBU_0974          CDS       T00124                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00071  Fatty acid degradation
cbu00072  Synthesis and degradation of ketone bodies
cbu00280  Valine, leucine and isoleucine degradation
cbu00310  Lysine degradation
cbu00362  Benzoate degradation
cbu00380  Tryptophan metabolism
cbu00620  Pyruvate metabolism
cbu00630  Glyoxylate and dicarboxylate metabolism
cbu00640  Propanoate metabolism
cbu00650  Butanoate metabolism
cbu00900  Terpenoid backbone biosynthesis
cbu01100  Metabolic pathways
cbu01110  Biosynthesis of secondary metabolites
cbu01120  Microbial metabolism in diverse environments
cbu01130  Biosynthesis of antibiotics
cbu01200  Carbon metabolism
cbu01212  Fatty acid metabolism
cbu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBU_0974
   00630 Glyoxylate and dicarboxylate metabolism
    CBU_0974
   00640 Propanoate metabolism
    CBU_0974
   00650 Butanoate metabolism
    CBU_0974
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CBU_0974
   00072 Synthesis and degradation of ketone bodies
    CBU_0974
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBU_0974
   00310 Lysine degradation
    CBU_0974
   00380 Tryptophan metabolism
    CBU_0974
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CBU_0974
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBU_0974
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CBU_0974
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbu04147]
    CBU_0974
Enzymes [BR:cbu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CBU_0974
Exosome [BR:cbu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBU_0974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-GeneID: 1208869
NCBI-ProteinID: NP_819982
UniProt: Q83CX7
Position
924656..925840
Genome map
AA seq 394 aa AA seqDB search
MENPIVIVSAARTPMGHYGGYFKEMPAPELGAAVIKAVVERAGLQPAEIDEVIMGCVLPA
GQGQAPARQAALKAGLPVSTPCTTINKMCGSGMKAIMLAHDEILADSYPHIIAGGMENMS
RAPYLMMKARFGYRLGHDRIYDHMMLDGLEDAYDKGKAMGVFAEKCVDKYQFTREALDKF
AIESLLRAKKANENGSFAPEIVPITITHQRETLTVDHDENAMKANPEKIPQLKPVFKADG
AVTAANSSSISDGAAAVTLMRLSEAKRLNIQPLAKIIGHFTYAEDPSWFTTAPIGAIRGL
LKKISWKKEAVDLFEINEAFAAVTMAAMKEIGLAHNKVNIHGGACALGHPIGASGARILV
TLLYALQKNNLQRGIASLCIGGGEATAIAIERGF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatccaattgttattgtaagtgcagcacgaacgcccatgggtcattacggcggt
tattttaaagagatgccagcaccagaattaggggctgcagttattaaagcggtggttgag
cgtgctggtttgcaacccgcggaaattgatgaagttatcatgggctgtgttttacccgcc
ggccaaggtcaagctccggcgcggcaagccgcactcaaagcgggtcttcccgtgagcacc
ccttgcactaccatcaataaaatgtgtggttcgggaatgaaggcgattatgctagcgcac
gatgaaatactcgccgactcctacccacatattatcgcgggtggaatggaaaatatgtct
cgcgcgccctatttaatgatgaaagcgcgcttcggttaccgtttgggacacgatcgaatt
tacgaccatatgatgcttgatggattggaagatgcctacgataagggaaaagcgatgggc
gtttttgccgagaaatgcgtggataaatatcaatttactcgcgaagcattggataaattt
gcaatcgaatccttgcttcgtgctaaaaaagccaacgaaaacggcagcttcgctccggaa
atagtcccgataacaatcactcatcaacgagaaaccttgactgtggatcatgatgaaaat
gccatgaaagccaatccagaaaaaattcctcaattaaaacctgtttttaaagccgatggt
gctgtaaccgccgctaattccagttccatttccgatggcgctgctgccgttacattaatg
cgtctatcagaagcaaaaagattaaatattcagccgctggcaaaaatcatcgggcatttc
acttacgcagaagatcctagttggttcaccaccgctccgattggcgctattcgcggatta
ttaaaaaaaatttcttggaaaaaagaagccgtggatttatttgaaatcaacgaagccttt
gctgctgtcaccatggccgcgatgaaagaaatcggccttgcccataacaaggtcaacatc
cacggcggcgcctgcgccttaggccatcccatcggcgcatccggtgcacgtattttggta
accttgttatacgctttacaaaaaaataatttacaacgcggcatcgcttctctgtgcatc
ggcggcggcgaagccacagcgattgcaattgaaaggggattttaa

DBGET integrated database retrieval system