KEGG   Coxiella burnetii RSA 493: CBU_1031Help
Entry
CBU_1031          CDS       T00124                                 

Definition
(RefSeq) lysozyme
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
cbu  Coxiella burnetii RSA 493
Brite
Enzymes [BR:cbu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     CBU_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_lysozyme E1_4HB DUF3475 P_C10 SIX1_SD
Motif
Other DBs
NCBI-GeneID: 1208929
NCBI-ProteinID: NP_820035
UniProt: Q83CS4
Position
974776..975216
Genome map
AA seq 146 aa AA seqDB search
MKMTREYAKQALEFLKRHEGFSPHLYKDSVGKWTIGYGRNLEDDPLHEYEAEFLLMQDIE
RLDKALSLHEAYQALDNERKAIILDMAYNLGYGGLMKFTHLWQALEKQDYEQAVKEMLNS
EWAEEVKSRATELAQLMDSSWVQNVR
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatgactagagaatacgcaaaacaagcgctcgaattcctcaaacgacatgaaggt
ttttcacctcatctttacaaagacagcgtcggcaaatggacgatcggctatggtcggaat
ctcgaagacgatccgctgcatgaatacgaggctgaatttttacttatgcaagacatcgaa
cgccttgataaggcgctctcacttcacgaagcttatcaagcgcttgataacgaacgaaaa
gccatcatcctcgacatggcctataacttaggctatggaggattaatgaaattcacccat
ctgtggcaggcactagaaaaacaagactatgaacaagctgtgaaggaaatgcttaatagt
gaatgggccgaagaagtgaaaagccgagcgactgaattggcccaattgatggattcttct
tgggttcaaaatgtgcgctga

DBGET integrated database retrieval system