KEGG   Coxiella burnetii RSA 493: CBU_1154Help
Entry
CBU_1154          CDS       T00124                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbu01100  Metabolic pathways
cbu01110  Biosynthesis of secondary metabolites
cbu01130  Biosynthesis of antibiotics
cbu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CBU_1154 (trpC)
Enzymes [BR:cbu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CBU_1154 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE ThiG His_biosynth QRPTase_C PDZ CC2D2AN-C2
Motif
Other DBs
NCBI-GeneID: 1209056
NCBI-ProteinID: NP_820151
UniProt: Q83CG4
Position
1099850..1100623
Genome map
AA seq 257 aa AA seqDB search
MHDYLKAILKNKKQEIAHLKANFSSDAFSLSTKKSFKRIISSTPTTIIAEIKRRSPSKGH
LAEIADPVALAKQYVQGGAAGVSVLTDKLAFDGSIRDLQQVSLELRDRPVAVLRKDFILD
PLQIEEAAVAGADAILLIVAILKDATKILLQKAHECGLEALVEVHNRQELDQAIEIGAEI
IGVNNRNLTTFSVDPNNALKLKPYIPDHIISVAESGIHTVSDAKRYISAGYNAVLVGEAL
VKSENPQQFISAIKEND
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcatgattatttaaaagcaattcttaaaaataaaaagcaggaaattgcgcatttgaaa
gcgaatttctcttccgacgctttttctctttcaactaaaaaatcctttaaaagaataatt
tcttctacgcctacaactatcattgccgaaattaaacggcgttctccttcaaaaggacat
ttagccgaaattgctgatccagtcgccttggcaaagcaatatgttcaaggaggtgctgcg
ggagtatcagtccttactgataaacttgcctttgatggttccattcgtgatttacagcag
gtcagccttgaattacgcgacaggcctgtagctgtccttcgcaaagattttattttagac
cctctacaaattgaagaagctgctgtcgccggtgctgatgcgatattattaattgtagca
attttaaaagacgcaacaaaaattttattacaaaaagcgcatgaatgcggtcttgaagcg
ttagtggaagtgcacaatcgtcaagaattggatcaagctattgaaatcggtgctgaaatt
attggggtcaacaatcgaaacttaactaccttttcggttgacccaaataatgcgcttaaa
ctaaaaccttacattcccgatcacatcataagcgttgctgaatcgggaattcacaccgta
agcgatgcaaaacgttatatttctgctggttacaacgccgttctcgtgggagaggcatta
gttaaatcagaaaatcctcaacaatttattagcgctattaaagaaaatgattga

DBGET integrated database retrieval system