KEGG   Coxiella burnetii RSA 493: CBU_1385Help
Entry
CBU_1385          CDS       T00124                                 

Gene name
tsf
Definition
(RefSeq) protein translation elongation factor Ts
  KO
K02357  elongation factor Ts
Organism
cbu  Coxiella burnetii RSA 493
Brite
KEGG Orthology (KO) [BR:cbu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cbu03012]
    CBU_1385 (tsf)
   03029 Mitochondrial biogenesis [BR:cbu03029]
    CBU_1385 (tsf)
Translation factors [BR:cbu03012]
 Eukaryotic Type
  Elongation factors
   CBU_1385 (tsf)
 Prokaryotic Type
   CBU_1385 (tsf)
Mitochondrial biogenesis [BR:cbu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CBU_1385 (tsf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF_TS HOIP-UBA TAP_C CUE
Motif
Other DBs
NCBI-GeneID: 1209291
NCBI-ProteinID: NP_820374
UniProt: Q9X5U9
Position
complement(1335200..1336090)
Genome map
AA seq 296 aa AA seqDB search
MTTITPIMVKELRERTGAAVMACKKALQETNGDMEAAIDLLRKAGDAKAAKRAGKTAAEG
VIVIAISKDQKKGFMAEVNSETDFVARDTNFMAFASKVAERGLAEGVSDVAATLALPIEP
NSSSTIEDERKALVNRIGENIQIRRVASLSSDGVVGHYSHGGRIGVLLALDVPNPELAKG
LAMHVAAFNPQAVSANQVSTEFVEKEKEIFLARAQETGKPANIIEKMVKGQVEKLLKEVS
LEGQSFVKDPEKLVGDLLKAEKAKVLAFLRFEVGEGVEKESQNFADEVMAQVQGNR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaattacaccgattatggttaaagagctgcgcgaacgcaccggtgctgcggtg
atggcgtgtaagaaggcgctgcaagaaaccaacggcgatatggaggccgccatcgatctt
ctgcgcaaagcgggagacgcaaaagcagcaaaacgcgctggaaaaacggcggctgaggga
gtgattgtcattgccatcagcaaagatcaaaagaaaggctttatggccgaagtaaatagc
gaaaccgattttgtggctcgagacactaattttatggctttcgcttccaaggtggccgag
cggggtttagcagaaggggtgagcgacgttgctgccacgctagcgcttccgattgaaccg
aattcttcttcaaccattgaagacgagagaaaagcgttggttaataggattggtgaaaat
attcaaattcgccgggtagccagtttatcctcggacggcgttgttggtcattatagccac
ggcggccgtatcggtgttttgctcgcactcgatgtgcctaaccctgaattggcgaaagga
cttgccatgcacgttgcggcttttaacccgcaagcggtgagtgctaatcaggtttccacc
gaatttgtggaaaaagaaaaggaaatctttttagcgcgagcccaagaaacaggaaaaccg
gcaaacattatcgaaaaaatggttaaaggccaggtggaaaaactcttaaaagaggtcagc
ttagaaggccaatctttcgtgaaagatcctgaaaagttggtcggtgatttgttgaaagca
gaaaaagcaaaagtgttagcattccttcgttttgaggtgggggaaggcgttgaaaaagaa
tcgcaaaattttgctgatgaggtaatggcgcaagtacaaggaaatcgttaa

DBGET integrated database retrieval system