KEGG   Coxiella burnetii RSA 493: CBU_1398Help
Entry
CBU_1398          CDS       T00124                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cbu  Coxiella burnetii RSA 493
Pathway
cbu00020  Citrate cycle (TCA cycle)
cbu00310  Lysine degradation
cbu01100  Metabolic pathways
cbu01110  Biosynthesis of secondary metabolites
cbu01120  Microbial metabolism in diverse environments
cbu01130  Biosynthesis of antibiotics
cbu01200  Carbon metabolism
Module
cbu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cbu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBU_1398 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CBU_1398 (sucB)
Enzymes [BR:cbu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CBU_1398 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CD99L2 DDHD HA2 FAM76 RTX_C
Motif
Other DBs
NCBI-GeneID: 1209304
NCBI-ProteinID: NP_820383
UniProt: Q83BU7
Position
complement(1350326..1351543)
Genome map
AA seq 405 aa AA seqDB search
MAIEIKVPTLPESVSDATVAKWYKKEGDSISRDENLVDLETDKVMLEVPAPKDGVVEKIV
AKEGEVVKADQILALLKEGGAVAKEKEKKDEKETKKEKEKKEEKKDKEKKEKTEEKESDL
SPAVRRMVSEKDVDVEEIEGSGKGGRITKKDVEDYLEKQKEKPSEGKEGPADERTEKRVP
LSRIRQRVAERLVQVQQEAALLTTFNEINMQLVMELRKKYREEFEKKFKVRLGFMSFFTK
AVVEALKRFPMVNASIDGSDIIYHNYYDIGIAIGTERGLIVPILRNAEKMNMADIEKQIR
EYASRAQEGRLNIEELTGGTFTITNGGTYGSLLSTPIINPPQTAILGMHKIMDRPTVENG
EVVVRPIMQVALSYDHRVIDGREAVLFLVTIKELLEDPARMILEC
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctatagaaattaaagtacctacgttgcctgaatcggttagcgatgccacggttgca
aagtggtataaaaaagaaggcgattccatttcacgggatgaaaatctagtcgatttggaa
acggataaagtcatgttggaggttcccgccccgaaagacggtgtggttgaaaaaatcgtc
gcgaaagaaggcgaagtcgttaaagccgatcaaatccttgcccttttaaaagaaggcggc
gctgtggccaaagaaaaagaaaagaaagacgaaaaagaaacgaaaaaagaaaaagagaaa
aaagaagaaaagaaagataaggaaaaaaaggaaaaaactgaagaaaaagaatctgatctc
agtcccgccgtgcgacgtatggtttcggaaaaagacgttgatgtcgaggaaattgaagga
agtggaaaaggagggcggattacgaaaaaagacgtggaagattatttagaaaaacaaaaa
gagaaaccctccgaaggaaaagaagggcctgccgatgaacgcacggaaaaacgcgtgcct
ttatcccgcatccggcaacgtgttgcggagcggttagtgcaagtccaacaagaagcggct
ttattaacgacgtttaatgaaattaacatgcagctggtaatggagttgcgaaaaaaatac
cgcgaagagttcgaaaagaaattcaaagttcgattgggttttatgtccttttttaccaaa
gccgtcgttgaagcgttaaaacgttttcccatggtaaacgcctcgatcgatggtagtgat
attatttatcacaattattacgacatcggtattgctattggcactgaacgcggattaatt
gtccctattcttagaaacgccgaaaaaatgaatatggccgatattgaaaaacaaattcgt
gaatacgcttctcgagctcaagaaggtcgtttgaatattgaggaactaacgggaggcact
tttacaattacgaatggcggaacttacggctcgcttctctcaacgcctataattaatccg
ccccaaaccgctattttggggatgcataaaataatggaccgtccaacggttgaaaacgga
gaagtcgtggttcgtccgatcatgcaagtggcattatcttacgatcatcgggtgattgac
gggcgagaagccgtgttatttttagtgaccattaaagagcttttggaagatccagctcga
atgattttggagtgttaa

DBGET integrated database retrieval system