KEGG   Clostridium butyricum: ATN24_03775Help
Entry
ATN24_03775       CDS       T04197                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbut  Clostridium butyricum
Pathway
cbut00071  Fatty acid degradation
cbut00280  Valine, leucine and isoleucine degradation
cbut00310  Lysine degradation
cbut00362  Benzoate degradation
cbut00380  Tryptophan metabolism
cbut00620  Pyruvate metabolism
cbut00630  Glyoxylate and dicarboxylate metabolism
cbut00640  Propanoate metabolism
cbut00650  Butanoate metabolism
cbut00900  Terpenoid backbone biosynthesis
cbut01100  Metabolic pathways
cbut01110  Biosynthesis of secondary metabolites
cbut01120  Microbial metabolism in diverse environments
cbut01130  Biosynthesis of antibiotics
cbut01200  Carbon metabolism
cbut01212  Fatty acid metabolism
cbut02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ATN24_03775
   00630 Glyoxylate and dicarboxylate metabolism
    ATN24_03775
   00640 Propanoate metabolism
    ATN24_03775
   00650 Butanoate metabolism
    ATN24_03775
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ATN24_03775
   00072 Synthesis and degradation of ketone bodies
    ATN24_03775
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ATN24_03775
   00310 Lysine degradation
    ATN24_03775
   00380 Tryptophan metabolism
    ATN24_03775
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ATN24_03775
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ATN24_03775
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ATN24_03775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbut04147]
    ATN24_03775
Enzymes [BR:cbut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ATN24_03775
Exosome [BR:cbut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ATN24_03775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALP89283
UniProt: A6N8U2
Position
1:797699..798880
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVSAVRTALGSFGGTLKDVSAVDLGATVIKEAITRAGVKPELVEEVIMGNVIQAG
LGQNTARQATIKAGLPNEVPAMTINKVCGSGLRSVSLAAQMIKAGDADIIVAGGMENMSA
APYALPTTRWGQRMNDGKIVDTMVKDALWDAFNNYHMGVTAENIAKEWGITKEEQDAFSA
SSQQKAERAIKEGRFKDEIVPVVIPQRKGEPKVFDTDEFPRFGTTAETLGKLKPCFIKDG
TVTAGNASGINDGAAAFVIMSAEKAEELGIKPLAKILSYGSKGLDPAIMGYGPFHATKKA
LEVANLTVEDLDLIEANEAFAAQSLAVAKDLKFDMDKVNVNGGAIALGHPVGASGARILV
TLLYEMEKRDSKKGLATLCIGGGMGTAVIVERM
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgtagttatagtaagcgctgtaagaacagcattaggatcttttggaggaaca
ttaaaggatgtttcagcagtagacttaggtgcaacagtaattaaggaagcaataacaaga
gcaggtgttaaaccagaattagtagaagaagttataatgggaaatgttatacaagcaggt
cttggacaaaacacagcaagacaagctacaataaaagctgggttaccaaatgaagttcca
gctatgacaatcaataaagtttgtggatcaggtttaagatcagttagtttagctgctcaa
atgattaaagcaggggatgcagatattatagttgcaggtggtatggaaaacatgtcagca
gcaccatatgcattaccaactactagatggggacaaagaatgaatgatggtaaaatagta
gatactatggttaaagatgcattatgggatgcttttaataattaccacatgggtgttaca
gctgaaaacatcgcaaaagaatggggaattacaaaggaagaacaagatgctttctcagca
tcatcacaacaaaaagcagaaagagctattaaagaaggaagatttaaagatgaaatagtt
ccagttgttattcctcaaagaaaaggtgaaccaaaagtatttgatactgatgaattccca
agattcggaacaacagcagaaactttaggaaaattaaaaccttgtttcattaaagatggt
acagttacagctggtaatgcatcaggaattaatgatggagcagcagctttcgtaataatg
agtgcagaaaaagcagaagaattaggaataaaaccacttgctaaaattctttcttatggt
tcaaaaggattagatccagctataatgggatacggtccattccatgcaactaaaaaagca
ttagaagtggctaatcttacagttgaagacttagacttaatcgaagcaaacgaagctttt
gcagctcaaagtttagcagtagctaaggatttaaaattcgatatggataaagtaaatgta
aatggtggagctatagctttaggacatccagtaggagcttcaggagcaagaatacttgtt
actcttctttatgaaatggaaaagagagactctaaaaaaggtttagctacattatgtatc
ggtggtggtatgggaactgctgtcatcgttgaaagaatgtaa

DBGET integrated database retrieval system