KEGG   Clostridium butyricum: ATN24_06015Help
Entry
ATN24_06015       CDS       T04197                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cbut  Clostridium butyricum
Pathway
cbut00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cbut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ATN24_06015
Enzymes [BR:cbut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ATN24_06015
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ATN24_06015
    1.1.1.-  
     ATN24_06015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 ApbA 2-Hacid_dh_C PALP Oxidored_nitro NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ALP89704
UniProt: A0A0Q0Y8J4
Position
1:1301169..1302245
Genome map
AA seq 358 aa AA seqDB search
MKAALWYAKKDVRVEEIEEPKVTVNGVKIKVKWCGICGSDLHEYLGGPIFIPVGQPHPLS
GTTAPVVLGHEFSGDVVEVGSDVTNFKPGDRVIVEPIVACGKCPACLEGKYNLCSSLGFH
GLCGSGGGLAEYTVFPEEFVHKIPDEMSYEQAALVEPMAVALHSIRVGNFRTGDTALVLG
SGPIGLATIECLKAAGAKLVIVLQRKSIRQEYAKRAGADVVLDPNEVNIAEEVKKLTNGL
GVDVAFETTGAQIGFDTGIDSLKFEGTMVITSIWEKGVTFNPNALVFTEKKIVGTLAYRH
EFQATMAQMKDGRIKAEGYVTKKIHLDDIVEEGFGALTGPEKKKHVKILVTPDKDLIS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcattatggtatgcaaagaaagatgttagagtagaggaaattgaagaacct
aaggttacagttaatggtgtaaagattaaagtaaaatggtgtggaatatgtggatcagat
ttacatgaatatttaggtgggcctatatttataccagtgggacaacctcatccattaagt
ggtacaacagctccagtagttctaggtcatgaattttcaggagatgtggttgaagttgga
tctgatgtaactaacttcaagccaggagatagagtaattgttgaacctatagttgcatgt
ggaaaatgtccagcatgtttagaaggaaaatataatttatgttcatcattaggtttccat
ggactttgtggaagcggcggaggacttgccgaatatacagtttttccagaagaattcgta
cataagataccagatgagatgtcttacgaacaagctgctttagttgaaccaatggcagtt
gcattacattcaattagagttggtaattttagaacaggtgatactgcattagtactagga
tctggtccaataggacttgcaactattgagtgcttgaaagcagcaggagcaaaattagta
atagtattacaaagaaagtctataagacaagagtatgcaaaaagagcaggagcagatgtt
gttttagatcctaatgaagtgaatatagcagaagaagttaaaaagcttacaaatggatta
ggagtagatgtagcatttgagactacaggagctcaaataggttttgatacaggtatcgat
agcttaaaattcgaaggaactatggttataacaagtatatgggaaaaaggagttacattt
aatcctaatgcattagtgtttacagaaaagaagatagttggaacattggcatatagacat
gagttccaagcaactatggctcaaatgaaggatggaagaataaaagcagaaggatatgta
acaaagaaaatacatttagatgatatagttgaagaaggttttggtgcattaacaggccct
gaaaagaagaaacatgttaagatattagtaacaccagataaggatcttatatcttaa

DBGET integrated database retrieval system