KEGG   Clostridium butyricum: ATN24_08820Help
Entry
ATN24_08820       CDS       T04197                                 

Definition
(GenBank) adenylylsulfate reductase
  KO
K00394  adenylylsulfate reductase, subunit A [EC:1.8.99.2]
Organism
cbut  Clostridium butyricum
Pathway
cbut00920  Sulfur metabolism
cbut01100  Metabolic pathways
cbut01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbut00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ATN24_08820
Enzymes [BR:cbut01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.99  With unknown physiological acceptors
    1.8.99.2  adenylyl-sulfate reductase
     ATN24_08820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 HI0933_like DAO Thi4 GIDA FAD_oxidored NAD_binding_8 Pyr_redox_3 Succ_DH_flav_C Trp_halogenase DUF5017 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ALP90236
UniProt: A0A427STP5
Position
1:1942781..1944487
Genome map
AA seq 568 aa AA seqDB search
MKKKLKVEKIETDLLIIGGGTAGCYAAITAAESSDLSILILEKANIKRSGCLAAGVNAIN
AYITKGRKPSDYVEYAKKDADNIVREDLLLTMAQGLNKVTENMENMGLVILKDENGEYVS
RGNRNIKINGENIKVILSQKIKKLSNVSVMNHVNVTDYIVKDNKIYGAFAFSIKDEVFYE
IKAKKVICATGGAAGLYKPNNSGFSRHKMWYPPFNTGAGYAMGINNGAEMTTFEMRFIAL
RCKDTIAPTGTIAQGAGAKQINSKGEIYETKYGLTTSERVYGTVMENLEGRGPCYLKTEG
ISSEMSEDLKKAYLNMAPSQTLKWIESGKNPSEENVEIEGTEPYIVGGHTASGYWVDTKR
ETTIKGLFAAGDVAGGCPQKYVTGALVEGEIAALEAVRQIKQEQSSIYEFSENDESSLLD
KKVLEAEEFLNFDKPLFSIEDLEEAMQKIMDTYAGGISRNYAYNEKQLNIADEKIDEVIN
LTNKLRAEDMHELMFVYELKERLTVCKSVIAHLRERKETRWHSFAENLDYREKSDEYLKY
INSKVIDGKLTVLFRDLVKEGETYEHIN
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaattaaaggttgaaaagatagaaactgatcttcttataataggaggggga
actgcaggatgctatgctgcaataacagctgcagaatcttcagatctttcaatattaata
ttggaaaaagctaatattaaaagaagtggatgtcttgcagcaggagtaaatgcaataaat
gcatacataacaaagggaagaaaaccttctgattatgtggaatatgcaaaaaaggatgca
gacaatattgtacgtgaggatttacttttaactatggcacaagggttaaacaaagttact
gagaacatggagaatatgggacttgtgattttaaaagatgaaaatggggaatatgtatca
aggggaaacagaaatataaaaatcaatggtgaaaatataaaagttattttatcacaaaaa
ataaaaaagctttccaatgtaagtgtaatgaatcatgtaaatgtaactgactatattgtg
aaagacaataaaatatatggagcttttgccttcagcataaaagatgaagttttttatgag
attaaagcaaaaaaagtaatatgtgcaacaggtggggcagcaggattgtacaagccaaac
aatagtggattttcaagacacaaaatgtggtatcctccatttaatactggagctggatat
gcaatgggaataaataatggtgcagaaatgacaacatttgaaatgagatttatagcatta
agatgcaaggacaccattgcacctactggcacaatagctcaaggagcaggagcaaaacag
attaattcaaaaggtgagatttatgaaactaaatatggacttacaacatcagaaagagtt
tatgggactgtaatggaaaatttagaaggtagaggtccatgctatttgaaaacagaaggc
ataagcagtgagatgagcgaagacttaaagaaagcatatcttaatatggcaccaagccag
actttaaagtggatagaatctggaaaaaatcctagtgaggagaatgttgaaattgaaggt
actgaaccatatattgttggtggtcatacagcaagtggttattgggtagatactaagaga
gaaactacaataaaaggactttttgcagcaggagatgttgcaggaggatgcccacagaag
tatgtgactggtgcacttgttgaaggagaaattgcagcacttgaggctgtaagacagatt
aaacaagaacaaagcagtatatatgaattttcagaaaatgatgaatcatcccttttagat
aaaaaggtactagaagcagaagaatttttgaattttgataaacctttatttagcattgag
gatttagaagaagctatgcagaagataatggatacatatgcaggaggcataagcagaaat
tatgcttacaatgaaaaacagcttaacattgcagatgaaaaaattgatgaagtaattaat
ctgacaaataagcttagagcagaagacatgcatgaattaatgtttgtttacgagctaaag
gaaaggcttactgtgtgtaaatctgtaattgcacatcttagagaaagaaaggaaactaga
tggcatagttttgcagaaaatctggattatagagaaaaaagtgatgagtatttaaaatat
ataaactcaaaagttattgatggaaagcttacagtattattcagagatttagtgaaagag
ggggagacttatgagcatatcaattaa

DBGET integrated database retrieval system