KEGG   Clostridium butyricum: ATN24_18025Help
Entry
ATN24_18025       CDS       T04197                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cbut  Clostridium butyricum
Pathway
cbut00480  Glutathione metabolism
cbut00590  Arachidonic acid metabolism
cbut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbut00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ATN24_18025
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ATN24_18025
Enzymes [BR:cbut01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ATN24_18025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF823
Motif
Other DBs
NCBI-ProteinID: ALR90350
UniProt: A0A3R9E9C2
Position
2:complement(213886..214362)
Genome map
AA seq 158 aa AA seqDB search
MEFYDLSATKMNGRKVSMEEYRGKVVLVVNTASKCGLTPQFTELEELYNEYKDNGFEVLG
FPCNQFAKQDPGSNKEIGEFCLRNYGVSFTMFEKIDVNGQNTHPIYKFLKNEAGGLIGRD
IKWNFTKFLIDSEGNVIKRYSPITKPSSIKKDIYSLIK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggaattttacgatttaagcgcgacaaaaatgaatggcaggaaagtaagcatggaagaa
tatagaggaaaggtagttcttgttgtgaatacagcaagtaaatgtgggttaacaccacag
tttacagagcttgaagaattatataatgaatataaagataatggatttgaggtattagga
tttccttgtaatcaatttgcaaaacaagatccgggaagtaataaagaaataggtgaattt
tgtcttagaaattatggagtaagctttacaatgtttgaaaaaatagatgtaaatggacaa
aacacacatcctatatataagttcttgaaaaacgaagctggaggattgattggaagagat
atcaaatggaatttcacaaaatttctaatagattcagaaggtaatgttataaagagatac
tcacccataacaaaaccttcaagtattaagaaagatatatacagccttataaaataa

DBGET integrated database retrieval system