KEGG   Clostridium baratii: U729_1140Help
Entry
U729_1140         CDS       T03506                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cbv  Clostridium baratii
Pathway
cbv00564  Glycerophospholipid metabolism
cbv01100  Metabolic pathways
cbv01110  Biosynthesis of secondary metabolites
Module
cbv_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:cbv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    U729_1140 (psd)
Enzymes [BR:cbv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     U729_1140 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AIY83472
UniProt: A0A0A7FV29
Position
complement(1238248..1239156)
Genome map
AA seq 302 aa AA seqDB search
MILVYNRTTKSYEEEKVAGKKYLDWCYESPAGKRLTELVFKKKLCSKVYGFFCDTRSSKK
KIPQFINDFNIDMNMYSKSASEFTTFNDFFARTVIPSARPIAKSKDTLISPVDGRVLAYE
HIDMNNLVQVKGITYSLSELLGDEKVANEYEGGTCLIFRLCPTDYHRYHFIDSGVSGKNH
YIKGNYYSVNPVAVDKIPKLFCQNKREWSVFKSDNFDNVLYVEVGATCVGSIIQSCPPGK
RVSKGDEKGYFKFGGSTVILFFKKNIVEIDKDIIEQTKLGYETKVLMGEKIGTKVLNKTF
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgtatataatagaactacaaaatcatatgaagaagaaaaagttgctggtaag
aaatacttagattggtgctatgaatcccctgctggtaaaagattaactgaattagtattt
aaaaagaagttatgttctaaggtttatggttttttctgtgatactagatcaagtaaaaag
aaaataccacagtttattaatgactttaatatcgatatgaacatgtattcaaagtcagca
tcagaattcactacatttaatgatttctttgcaagaactgtaattccaagtgcaagacct
atagctaaatcaaaagatactttaatatctccagttgacggtagagttttagcatatgaa
catatagatatgaataatcttgtccaagtaaaaggtataacttatagtttaagtgaatta
ttaggagacgagaaagttgctaatgagtatgaagggggaacctgcttaatctttagatta
tgtcctactgattaccatagatatcactttatcgattctggtgtttcaggaaaaaatcat
tacataaaaggaaattactattccgtaaatccagttgctgtagataaaataccaaaacta
ttttgccaaaataagcgtgaatggtctgtatttaaatctgataattttgataatgtgtta
tatgtcgaagttggagcaacttgtgttggtagcataattcaaagttgtcctcctggaaaa
agagtttctaaaggtgatgaaaaaggatactttaaatttggtggttcaactgtaatttta
ttctttaagaaaaatattgtagaaatcgataaagatattatagaacaaactaaactagga
tatgaaactaaggtgcttatgggtgaaaaaataggtactaaagtattgaataaaactttt
aaattgtaa

DBGET integrated database retrieval system