KEGG   Clostridium baratii: U729_288Help
Entry
U729_288          CDS       T03506                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cbv  Clostridium baratii
Pathway
cbv00051  Fructose and mannose metabolism
cbv01100  Metabolic pathways
cbv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    U729_288
Enzymes [BR:cbv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     U729_288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II Myosin_N
Motif
Other DBs
NCBI-ProteinID: AIY83221
UniProt: A0A0A7FWL5
Position
complement(295039..295743)
Genome map
AA seq 234 aa AA seqDB search
MENANELKYMEIREQICDVCHKMWQLGWVAANDGNVTVKLEDGTFLATPTGISKSFITPE
KLVHIDENGEILDGPEGAKPSSEIKMHLRCYKEREDVGAVVHAHPPTATGFAVAHLDLDR
YTMIETVIAIGSIPITPYGTPSTYEVPDSIAPYLQEHDVLLLENHGALTVGADLITAYYR
METLELYAKISLTAHLLGGEKEISRKNIDRLIGMRKDYGVSGRHPGFKRYRKEE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgcaaacgaattaaaatacatggaaataagagaacagatatgtgatgtatgc
cataaaatgtggcaattaggatgggttgcggccaatgatggtaatgtaacagtaaaatta
gaagatggcacatttttagcaacaccaactggaattagtaaaagctttataactccagaa
aagttagtgcatattgatgaaaatggagaaatacttgatggaccagaaggagcaaaacct
tcatcagaaataaaaatgcacctaagatgctacaaagaaagagaagatgttggtgctgtt
gtccatgcgcatccaccaactgcaacaggctttgcagtagcgcatcttgatttagacaga
tatacaatgatagaaactgttattgcaattggttcaatcccaataacaccttatggaacg
ccatcaacttatgaagttccagattcaatagcaccatatcttcaagaacatgatgtttta
ttgttagaaaatcatggagcattaacagttggagctgatttaataacagcttattataga
atggaaacattagaattatatgcaaaaataagtttaacagctcatcttttaggaggagaa
aaagaaatatcaagaaaaaatattgatagattaataggtatgagaaaagattatggagta
agtggaagacaccctggatttaagcgttatagaaaagaagaataa

DBGET integrated database retrieval system