KEGG   Cupriavidus basilensis: RR42_m0050Help
Entry
RR42_m0050        CDS       T03642                                 

Definition
(GenBank) Glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00480  Glutathione metabolism
cbw00590  Arachidonic acid metabolism
cbw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    RR42_m0050
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RR42_m0050
Enzymes [BR:cbw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RR42_m0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AJG17465
UniProt: A0A0C4Y3M0
Position
main:complement(82195..82746)
Genome map
AA seq 183 aa AA seqDB search
MASTLYDIPLKRIDGTDSRLADFRARVLLVVNVASKCGLTPQYEGLEALYQAKRAEGLEV
LGFPANNFKGQEPGDEAQIQEFCTLTYDVHFPMFSKVSVLGPDQHPLYAALTQAQPAAIG
DGPFRERLKGYGVNPENATDVLWNFEKFLIDREGNVVARFAPDVAANDPRLLEAIDAALG
QGR
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaccttgtacgacatccccctgaaacgcatcgacggtaccgacagccggctc
gcggattttcgcgctcgtgtgctgctggttgtgaacgtggcatcgaagtgcggcctgacg
ccccagtacgaagggctcgaagcgctgtaccaggccaagcgcgccgagggcctggaggta
ctgggattcccggccaacaacttcaagggccaggagccgggcgacgaggcgcagatccag
gaattctgcacgctgacctacgacgtgcacttcccgatgttctcgaaggtgtcggtgctc
gggccggaccagcatccgttgtacgcggcgttgacgcaagcgcagccggccgccatcggc
gacggccctttccgtgagcgcctgaagggctacggcgtgaacccggagaacgccaccgat
gtgctgtggaacttcgagaagttcctgatcgaccgggaaggcaacgtggtagcgcgcttc
gcgccggacgtcgcggcgaacgatccgcgcctgcttgaggcgatcgatgcggcgctgggc
cagggccgctga

DBGET integrated database retrieval system