KEGG   Cupriavidus basilensis: RR42_m0113Help
Entry
RR42_m0113        CDS       T03642                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A or Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00970  Aminoacyl-tRNA biosynthesis
cbw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RR42_m0113
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cbw03029]
    RR42_m0113
Enzymes [BR:cbw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RR42_m0113
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RR42_m0113
Mitochondrial biogenesis [BR:cbw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RR42_m0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AJG17528
UniProt: A0A0C4Y406
Position
main:155929..157413
Genome map
AA seq 494 aa AA seqDB search
MTSLRELSDALAARSVSAEELARDYLARIEQAGALNAFVDVNPELTLAQARAADARRARG
EAGPLTGVPIAHKDVFVTRGWRATAGSRMLANYESPFDAAVVERLAAAGMVTLGKTNMDE
FAMGSSNENSHFGPVRNPWDASRVPGGSSGGSAAAVAAGLAPAATGTDTGGSIRQPASFS
GITGIKPTYGRVSRYGMIAFASSLDQGGPMAHTAEDCAMLLGGMAGFDERDSTSVAPALG
GVDEDYTRLLGQARAGASAGKPLSGLRIGLPKEYFGKGLAADVEQAVRAALAEYEKLGAT
LVEVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRFGHRAAEYRDLMDMYKKTRAEGFGP
EVKRRIMVGAYVLSHGYYDAYYLQAQKIRRIIADDFQRAFTQCDVIMGPVAPTVAWKLGE
KSADPVQMYLADIFTLSTSLAGLPGMSVPCGLGEGGMPVGLQLIGNYFGEAELLQTAHAF
QQATDWHLRRPAQA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgacctccctgcgcgagctttccgacgcgctggcggcccgctccgtctccgccgaagaa
ctggcgcgcgattacctggcccgtatcgagcaggccggcgcgctcaacgcctttgtcgac
gtcaaccccgaactcaccctggcgcaggcgcgtgccgccgacgcgcgccgcgcgcgcggc
gaagccggcccgctgaccggcgtgccgattgcccacaaggatgtgttcgtcacccgtggc
tggcgcgccacggcgggctcgcgcatgctggccaactacgaaagcccgttcgacgcggcc
gtggtcgagcgcctcgccgccgccggcatggtcacgctgggcaagaccaatatggacgag
ttcgcgatgggctcgtccaatgagaactcgcacttcggcccggtccggaacccctgggac
gccagccgcgtgccgggtggctcctcgggcggctccgctgccgccgtggccgccggcctg
gcgcctgccgccaccggcaccgacaccgggggctcgatccgccagccggcctcgttctcc
ggcatcaccggcatcaagcctacctatgggcgcgtgtcgcgctacggcatgatcgccttc
gcctcctcgctcgaccagggcggcccgatggcgcataccgccgaggattgcgccatgctg
ctgggcggcatggccggcttcgacgagcgcgactccaccagcgttgcgcccgccctgggc
ggcgtcgacgaggactacacccgcctgctgggccaggcgcgggctggcgccagtgccggc
aagccgttgtcagggctgcgcatcggcctgccgaaggaatatttcggcaagggcctggca
gcggacgtggagcaggccgtgcgcgcggcgcttgccgagtacgaaaagctgggcgccacg
ctggtcgaggtgtctctgcccaagaccgaactgtcgatccccgtgtactacgtgatcgcg
ccggccgaggcatcgtccaacctgtcgcgctttgacggcgtgcgctttggccatcgcgcc
gccgagtaccgcgacctgatggacatgtacaagaagacccgcgccgaaggcttcggcccc
gaggtcaagcgccgcatcatggtgggcgcctatgtgctgtcgcacggctactacgacgcc
tactacctgcaggcacaaaagatccgccgcatcattgctgacgatttccagcgcgccttc
acccagtgcgacgtgatcatgggcccggtggcgcccacggtggcgtggaagctcggcgag
aagagcgcggacccggtgcagatgtacctggccgacatcttcacgctgtcgaccagcctg
gccggcctgccgggcatgagcgtgccctgcgggctgggcgagggcggcatgccggttggc
ctgcagctgatcggcaactactttggcgaggccgagctgctgcaaacggcgcacgccttc
cagcaggcaacggactggcacctgcgccggcccgcgcaggcatga

DBGET integrated database retrieval system