KEGG   Cupriavidus basilensis: RR42_m0186Help
Entry
RR42_m0186        CDS       T03642                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00780  Biotin metabolism
cbw01100  Metabolic pathways
Module
cbw_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RR42_m0186
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbw01007]
    RR42_m0186
Enzymes [BR:cbw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     RR42_m0186
Amino acid related enzymes [BR:cbw01007]
 Aminotransferase (transaminase)
  Class II
   RR42_m0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Herpes_UL49_2
Motif
Other DBs
NCBI-ProteinID: AJG17601
UniProt: A0A0C4YAR8
Position
main:222278..223495
Genome map
AA seq 405 aa AA seqDB search
MLLEHLTLAAAERDEKALTRRRRTAYSACAPQQAVSDACGGEMHSLLTFCSNDYLGLANH
PALIAAMAEGARQFGAGSGASHLVSGHSLAHHRLEGELAAWFAPNIPHAAALYFSTGYMA
NMAVLTALGSADATLFCEALNHASLIDGARLARAEVRRYAHRNMAELEGLLVASTSPLKL
IVTDSVFSMDGDFAPLAELLALAERHDAWIILDDAHGFGVLGEQGHGVLEHLALTSPRFI
YIGTLGKAAGVAGAFVAAHETIIDHLVNTARQYIYTTASPPAVAHALSASLALIAGDEGR
QRRAQLDKLIHTLRSGLAGLTRAAGWRLGESSTAIQPVIVGDNVAALALSAALEADGIRV
GAIRPPTVPVGTARLRITLSASHTVADVERLLASLASVVPRKEAS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttgagcacttgaccctggccgccgccgagcgcgacgaaaaggcactgacgcgg
cgccgccgcaccgcgtactccgcctgtgcgccgcagcaagccgtgagcgatgcctgcggc
ggcgagatgcactcgttgctgacgttctgcagcaacgactacctgggcctggccaaccat
cccgcgctgatcgcggccatggccgagggcgcgcgccagttcggcgcgggtagcggggcc
tcccacctggtgagcggccattcgctggcccaccaccggctcgaaggggagctggcggcg
tggttcgcgccgaacattccgcacgcggccgcgctctacttcagcaccggctatatggcc
aacatggcggtgctgaccgcgctaggcagcgccgatgccacgctcttttgcgaagcgctc
aaccatgcctcgctgatcgacggcgcgcgcctggcgcgcgccgaggtccgccgctatgcg
catcgcaacatggccgagctcgagggcttgctggtcgccagcaccagcccgctcaagctg
atcgtcaccgacagcgtgttcagcatggacggcgacttcgcgccgctggccgagctgctg
gcgctggccgagcggcacgatgcctggatcatcctggatgacgcgcatggcttcggcgtg
ctgggcgagcaaggccacggcgtgctggagcacctcgcgctgacgtcgccgcgcttcatc
tatatcggcacgctgggcaaggccgccggcgtggcgggcgcgttcgtggccgcgcacgag
accatcatcgatcatctcgtcaacaccgcgcggcagtacatctacaccacggcctcgccg
ccggctgtggcgcacgccttgtccgccagcctggcgttgatcgccggcgacgaagggcgg
caacgccgcgcgcagctcgataagctgatccatacgctgcgcagcggcctggccggcctg
acgcgggcggctggctggcgcctgggcgagagttcgacggcgatccagcccgtgatcgtg
ggcgacaacgtagcggcgctggcactgtccgcggcgctggaggccgacggcatccgcgtt
ggcgcgatccgcccgcccaccgtgcccgttggtaccgcgcgcctgcgcatcacgctgtcg
gcctcgcataccgtggccgatgtcgagcgcctgctggccagcctggccagcgtggtgccg
cgcaaggaggcgtcatga

DBGET integrated database retrieval system