KEGG   Cupriavidus basilensis: RR42_m0612Help
Entry
RR42_m0612        CDS       T03642                                 

Definition
(GenBank) Malonate decarboxylase alpha subunit
  KO
K13929  malonate decarboxylase alpha subunit [EC:2.3.1.187]
Organism
cbw  Cupriavidus basilensis
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbw02000]
    RR42_m0612
Enzymes [BR:cbw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.187  acetyl-S-ACP:malonate ACP transferase
     RR42_m0612
Transporters [BR:cbw02000]
 Other Transporters
  Primary active transporters [TC:3]
   RR42_m0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mal_decarbox_Al CoA_trans
Motif
Other DBs
NCBI-ProteinID: AJG18025
UniProt: A0A0C4Y501
Position
main:complement(658069..659667)
Genome map
AA seq 532 aa AA seqDB search
MARGAAFASGRVVPTADIVPFLEAITAPGDRVVLEGNNQKQADFLSRSLAEVDPAKVHGL
HMIIPSVSRVEHLDLFERGIARKLDFAFAGAQSLRISQFLEDGQLEVGAIHTYIELYARL
YVDLTPNIVLIAGYKADRDGNLYTGASTEDTPALVEAATFRDGIVVAQVNEIVDDPAGLP
RVDIPGSWIDYVVQADKPFFCEPLFTRDPRLIKPVHVLMAMMAIRGVYERHQVQSLNHGI
GFNTAAIELILPTYGESLGLKGKICKYWTLNPHPTLIPAIESGWVQSVHSFGSELGMENY
VAARPDVFFTGADGSMRSNRAFCQLAGQYAVDLFIGSTLQIDGDGHSSTVTRGRLSGFGG
APNMGHNPGGRRHPTPAWLDLIETDDPLARGRKLVVQMVETFQAGGKPTFVESLDAVQVA
KDSGMPLAPVMIYGDDVTHVLTEEGIAYLYKARSLEERRAMLAAVAGVTPIGLRHDTSTT
RRMRSDGLIALPEDLGVQRSQATRSLLAAKSMADLVDWSGGLYEPPARFRSW
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcggcgccgcctttgccagcggccgggtcgtgcccaccgccgacatcgtccca
ttcctcgaagccatcaccgcgccgggcgaccgcgtggtgctggagggcaacaaccagaag
caggccgacttcctctcgcgctcgctggccgaggtggacccggccaaggtccacggcctg
cacatgatcatcccgagcgtgagccgggtggagcatctcgacctgttcgagcgcggcatc
gccaggaaactggacttcgcttttgccggcgcgcagagcctgcgcatctcgcagttcctg
gaagatggccagcttgaggtcggcgccatccacacctacatcgaactgtacgcgcggctc
tatgtggacctgacgcccaacatcgtgctgatcgccggctacaaggccgaccgcgacggc
aacctctacaccggcgccagcaccgaggacacgcccgcgctggtggaggccgcgactttc
cgcgacggcatcgtggtggcccaggtcaacgagatcgtggatgaccccgccgggctgccg
cgcgtggatatccccggctcctggatcgactacgtggtgcaggccgacaaacccttcttc
tgcgagccgctgttcacgcgcgacccgcgcctgatcaagccggtgcatgtgctgatggcc
atgatggcgatccgcggcgtgtacgagcgccaccaggtgcagtcgctcaaccatggcatc
ggctttaacaccgctgccatcgaactgatcctgccgacctatggcgagtcgctcggcctc
aagggcaagatctgcaagtactggacgctcaacccccaccccacgctgatccctgccatc
gagtcgggctgggtacagagcgtgcacagctttggcagcgagctcggcatggagaactat
gtggccgcgcgcccggatgtgttcttcaccggcgcggatggatcgatgcgctccaaccgc
gccttctgccagcttgccggccagtacgcggtggacctgttcatcggctccacgctgcag
atcgacggcgacggccactcctccacggtcacgcgcgggcgcttgtccggttttggcggc
gcgcccaacatgggccacaacccgggcggccggcgtcatcccacgccggcgtggctcgac
ctgatcgagaccgacgacccgctcgcgcgcggccgcaagctggtggtgcagatggtggag
accttccaggctggcggcaagccgacctttgtcgaatcgctcgatgcggtgcaggtggcc
aaggacagcggcatgccgctggcgccggtgatgatctacggcgacgacgtaacgcacgtg
ctgaccgaggaaggcatcgcctatctctacaaggcacgctcgctggaggagcgccgcgcc
atgctggcggctgtggccggggtgacgccgatcggcctgcgccacgacaccagcaccacg
cgccgcatgcgcagcgatggcctgatcgcgctgcccgaagacctcggcgtgcagcgcagc
caggctacgcgctcgctgctggcggccaagagcatggccgacctggtcgactggtccggc
gggctgtacgagccgccggcacgcttccggagctggtga

DBGET integrated database retrieval system