KEGG   Cupriavidus basilensis: RR42_m3071Help
Entry
RR42_m3071        CDS       T03642                                 

Definition
(GenBank) Valyl-tRNA synthetase
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RR42_m3071
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbw01007]
    RR42_m3071
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbw03016]
    RR42_m3071
Enzymes [BR:cbw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     RR42_m3071
Amino acid related enzymes [BR:cbw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RR42_m3071
Transfer RNA biogenesis [BR:cbw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    RR42_m3071
 Prokaryotic type
    RR42_m3071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 Val_tRNA-synt_C tRNA-synt_1g tRNA-synt_1_2 tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: AJG20441
UniProt: A0A0C4YI61
Position
main:3266335..3269202
Genome map
AA seq 955 aa AA seqDB search
MTAQDQSLAKSFEPAAIEAKWGPEWEKRGIAKPTLDPDRPDFCIQLPPPNVTGTLHMGHA
FNQTIMDGLARHARMRGANTLWVPGTDHAGIATQIVVERQLEAQGVSRHELGREKFVEKV
WEWKEESGSTITRQIRRMGASIDWSHEYFTMSPEMSKAVTEVFVRLFEQGLIYRGKRLVN
WDPVLGTAVSDLEVDNVEEDGSMWHIRYPLAEADTAHGLTHLTVATTRPETMLGDVAVMV
HPQDERYAHLIGKFVRLPLTGRDIPVIADDYVDREFGTGVVKVTPAHDFNDYAVGQRHKL
AQLSILTLDAKIVADAPAAYAGLDRFEARTRIVADLDAQGLLAEVKKHKLMTPRSERTGS
AIEPMLTDQWFVAMSKPAPEGTYHPGRSIAEVALDAVQSGEIKLIPDNWNSTYNQWLENI
QDWCISRQLWWGHQIPAWYDEAGKCFVARTEEEAQAQARAAGSTGPLRREDDVLDTWFSS
ALVPFSSLGWPAETPALQHFLPSSALVTGYDIIFFWVARMVMMTKHFTGKVPFHTVYVHG
LVRDSEGKKMSKSEGNTLDPVDLIDGIELEPLLKKRTTGLRRPKDAPKIEKKTKKEFPEG
IPAFGADALRFTFASLATLGRNINFDTGRCEGYRNFCNKLWNATRFVLMNTEGHDCGMGP
CSNDCGPDGYLHFSQPDRWIVSLLQRVEAEVEKGFAEYRFDNIASAIYKFVWDEYCDWYL
ELAKVQIQNGTPAQQRATRRTLLRVLETVLRLAHPIIPFITEELWQKVAPLAGRAKGDGS
ETLALQAYPLPAMAKIDEAAEQWTAQLKAVVDACRNLRGEMNISPAQRIPLYAEGDSAFL
TSAQAYVQALAKLSEVKVFEDQNALMAEGAGAPVAIVGGNHLLLKIEIDVAAERVRLSKE
IERISAELGKCRGKLSNESFVAKAPPAVVAQETQRLSDFEQTLVKLQDQLQRLPA
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccaagaccagtcccttgccaagagcttcgaacccgccgccattgaggccaag
tggggcccagagtgggagaagcgcggcatcgcgaagccgaccctcgatccggaccgtccg
gacttctgcatccagctgccgccgcccaatgtgaccggcacgctgcacatgggccatgcc
ttcaaccagaccatcatggacggcctggcccgccatgcccgcatgcgcggcgcaaacacc
ctgtgggtgccgggcaccgaccacgccggcatcgccacccagatcgtggtggagcgccaa
ctggaagcgcaaggcgtttcgcgccatgagctgggccgcgagaagttcgtcgagaaggtg
tgggagtggaaggaagagtccggctcgacgattacgcgccagatccgccgcatgggcgcc
tcgatcgactggagccatgagtacttcacgatgtcgccggaaatgtccaaggcggtcacc
gaagtcttcgtgcgcctgttcgagcaaggcctgatctaccgcggcaagcgcctggtcaac
tgggacccggtgctgggcaccgcggtgtcggacctggaagtggacaacgtcgaggaagat
ggctcgatgtggcacatccgctatccgctggccgaggccgataccgcgcacggcctgacc
cacctgacggtggccaccacccgccccgagaccatgctgggcgacgtggccgtgatggtg
cacccgcaagacgagcgttatgcgcacctgatcggcaagtttgtacgcctgccgctcacc
gggcgcgatatcccggtgatcgccgacgactacgtcgaccgcgaattcggcaccggcgtg
gtcaaggtgactcccgcccatgatttcaacgactatgcggttggccagcgccacaagctg
gcgcagctgtccatcctgacgctcgacgccaagatcgtcgccgacgcgcccgccgcctat
gccggcctggaccgcttcgaggcgcgcacccgcatcgtggcggacctggatgcccagggc
ctgctggccgaggtcaagaagcacaagctgatgacgccgcgcagcgagcgcactggcagc
gccatcgagccgatgctgaccgaccagtggttcgtcgccatgagcaagccggcgccggaa
ggcacctaccacccgggccgctcgattgccgaagtggcgctggacgccgtgcagagcggc
gagatcaagctgatccccgataactggaacagcacctacaaccagtggctggagaacatc
caggactggtgcatctcgcgccagctgtggtggggccaccagatcccggcctggtacgac
gaggccggcaagtgcttcgtcgcccgtaccgaggaagaggcgcaggcccaggcgcgcgcg
gccggcagcaccgggccgctgcgccgcgaggacgatgtgctcgacacctggttctcctcg
gccctggtgcccttctcgtcgctgggctggcccgccgagacgccggcgttgcaacacttt
ctgccgtcgtcggcacttgttaccggttacgacatcatcttcttctgggtggcgcgcatg
gtcatgatgaccaagcactttaccggcaaggtgccgttccataccgtctatgtgcacggt
ctggtgcgggattcggaaggcaagaagatgagcaagtccgagggcaacaccctggacccg
gtcgacctgatcgacggcatcgagctcgagccgctgctcaagaagcgcaccaccggcctg
cgccgccccaaggacgcgcccaaaatcgagaaaaagaccaagaaggagttccccgagggc
attccggcgtttggcgccgatgcactgcgtttcaccttcgcctcgctggccacgctgggc
cgcaacatcaacttcgacaccggccgctgcgaaggctatcgcaacttctgcaacaagctg
tggaacgccacgcgcttcgtgctgatgaacaccgaagggcacgactgcggcatgggcccg
tgcagcaacgactgcggccccgacggctacctgcatttctcgcagccggaccgctggatc
gtgtcgctgctgcagcgcgtggaagccgaagtggaaaagggctttgccgagtaccgcttc
gacaatatcgccagcgccatctacaagttcgtctgggacgagtactgcgactggtacctg
gaactggccaaggtccagatccagaacggcacgccagcgcagcagcgcgccacccgccgc
acgctgttgcgcgtgctggaaaccgtgctgcgcctggcccacccgatcatccccttcatc
accgaagaactgtggcagaaggtagcgccgctggccggccgcgccaagggcgacggcagc
gagacgctggcgctgcaggcctatcccctgcccgccatggcaaagatcgacgaggccgcc
gagcaatggaccgctcagctcaaggccgtggtcgacgcctgccgcaacctgcgcggcgaa
atgaacatctcgccggcccagcgcattccgctgtacgctgagggcgacagcgcgttcctg
acgtcggcccaggcttatgtgcaggcgctggcaaagctttcggaggtcaaggtattcgaa
gatcagaatgccctgatggcggaaggtgccggcgcgccggtggccatcgtcggcggcaac
catctgctgctgaagatcgaaatcgacgtggccgcggaacgcgtgcgcctgtccaaggaa
atagagcgcatcagcgccgaactcggcaagtgccgtggcaagctgtccaacgagagcttc
gtcgccaaggcaccgcccgccgtcgtcgcgcaagaaacccagcgtctgtcggatttcgaa
cagacgctggtcaagctgcaggatcaactacagcgattgccggcatga

DBGET integrated database retrieval system