KEGG   Cupriavidus basilensis: RR42_m3475Help
Entry
RR42_m3475        CDS       T03642                                 

Definition
(GenBank) Isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RR42_m3475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbw01007]
    RR42_m3475
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbw03016]
    RR42_m3475
Enzymes [BR:cbw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     RR42_m3475
Amino acid related enzymes [BR:cbw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RR42_m3475
Transfer RNA biogenesis [BR:cbw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RR42_m3475
 Prokaryotic type
   Other AARSs
    RR42_m3475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e zf-FPG_IleRS tRNA-synt_1f tRNA-synt_1_2 ADK_lid
Motif
Other DBs
NCBI-ProteinID: AJG20841
UniProt: A0A0C4YJG4
Position
main:3697378..3700269
Genome map
AA seq 963 aa AA seqDB search
MSNDKRAKPEKSKYPVNLLETPFPMRGDLPKREPLWVKQWQDKQLYKKIRAARKGAKKFI
LHDGPPYANGDIHIGHAVNKVLKDMIVKARGLTGLDAVYVPGWDCHGMPIEIQIEKQFGK
GLPVQEVQSRARAYATEQIARQKLDFERLGVLGDWEHPYMTMNFSNEADELRALSKIMEK
GYVFRGLKPVNWCFDCGSALAEAEVEYKDKTDLSIDVGFPFAETDKLAHAFKLPAEQLAA
KPGWVVIWTTTPWTIPSNQALNMHPEVEYALVDTSRGFLILATERVEEQLKIYELEGKVL
ATTTGAALSEIRFHHPLSKMDAGYDRLSPIYLGDYVTTDTGTGIVHSAPAYGVEDFQSCK
AHGMNDKDIISPVMGDGVYASTLPLFGGQKIWDANPKIVEVLKASGNLFNSHKYTHSYMH
CWRHKTPIIYRATSQWFAGMDVDPVNEDGTNGPTLRETALAGIEATEFYPAWGKQRLHNM
IANRPDWTLSRQRQWGVPMAFFLHKETGALHPRTPELLEAIAKRVEVHGIEAWQALDPKE
LLGEEAAMYEKNRDTLDVWFDSGTTHWTVIRGSHREDLYDASADLPDGRLADLYLEGSDQ
HRGWFHSSLLTASMLYGKPPYKALLTHGFTVDGEGRKMSKSVGNTVSPQDVSNKMGAEII
RLWVASTDYSGELSISDEILKRVVEGYRRIRNTLRFLLANLADYDHAQHALPASEWLEID
RYAVALTGRLQQEILSHYDGYEFHPVVAKLQTFCSEDLGGFYLDVLKDRLYTTAANAKER
RAAQNAVYHITQAMLHWMAPFLSFTAEEAWQIFGHGTEHTDTIFTSTYYDVPAIDQADDL
LQKWHVIREARAEVTKQLEAVRVDGEIGSSLQAEVTIQAGGPVLAALQSLSDDLRFVLLT
SAAKVAPAPEGGDLLVTVTPSVHAKCERCWHYRADVGRDPAHPTLCGRCDSNLFGAGEHR
SHA
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgacaaacgcgccaagcccgaaaaaagcaagtacccggtcaacctgctcgag
acccccttcccgatgcgcggcgacctgcccaagcgcgagccgttgtgggtcaagcaatgg
caggacaagcagctctacaagaagatccgggccgctcgcaagggcgccaagaagttcatc
ctgcacgacggccccccgtatgccaacggtgacatccacatcggccatgcggtcaacaag
gtcctcaaggacatgatcgtcaaggcgcgcggcctgaccgggctggacgccgtctatgtg
ccgggctgggactgccacggcatgccgatcgagatccagatcgaaaagcagttcggcaag
ggcctgccggtgcaggaagtgcaatcgcgcgcccgagcctacgccaccgagcagattgcc
cgccagaagctggacttcgagcgcctgggcgtgctgggtgactgggaacatccctacatg
accatgaacttcagcaacgaagccgacgagctgcgcgcgctgagcaagatcatggaaaag
ggctacgtgttccgcggcctgaagccagtgaactggtgcttcgactgcggctcggcgctg
gccgaggccgaggtcgagtacaaggacaagaccgatctgtccatcgacgtgggcttcccc
ttcgccgaaaccgacaagctggcccatgccttcaaactgccagccgaacagctcgccgcc
aagccgggctgggtggtgatctggaccaccacgccctggaccatcccgtccaaccaggcg
ctgaacatgcacccggaagtcgagtacgcgctggtcgatacctcgcgcggcttcctgatc
ctggccaccgagcgcgtcgaagagcagctcaagatctacgaactggaaggcaaggtgctg
gccaccaccaccggcgcagcgctgtcggagatccgcttccaccacccgctgtccaagatg
gacgcgggctacgaccgcctgtcgccgatctacctgggcgactacgtcaccaccgatacc
ggcaccggcatcgtgcactcggcgccggcctacggcgtggaggatttccagtcgtgcaag
gcgcacggcatgaacgacaaggacatcatcagcccggtcatgggcgacggcgtctatgcc
agcacgctgccgctgttcggcggccagaagatctgggacgccaaccccaagatcgtcgaa
gtgctgaaggcctcgggcaacctgttcaattcgcacaagtacacccacagctacatgcac
tgctggcgccacaagacgccgatcatctaccgcgccacctcgcagtggttcgcgggcatg
gacgtggatccggtcaatgaagacggcaccaacggcccgaccctgcgcgaaaccgcgctc
gccggcatcgaggcaaccgagttctacccggcgtggggcaagcagcgactgcacaacatg
atcgccaaccggcccgactggaccctgtcgcgccagcgccagtggggcgtgccgatggcc
ttcttcctgcacaaggaaaccggcgcgctgcacccgcgcacgcccgaattgctggaggca
atcgccaagcgcgtggaagtgcacggcatcgaagcctggcaggcgctcgatcccaaggaa
ctgctgggcgaagaagccgccatgtacgagaagaaccgcgacacgctcgacgtgtggttc
gactcaggcaccacgcactggaccgtgatccgaggctcccaccgcgaagacctgtacgac
gcatcggccgacctgcccgacggccgcctggctgacctgtacctggaaggctcggaccag
catcgcggctggttccattcgtcgctgctgaccgcctcgatgctgtatggcaagccgccc
tacaaggcgctgctgacccacggcttcacggtggacggcgaaggccgcaagatgtcgaag
tcggtcggcaacacggtatcgccgcaggacgtatcgaacaagatgggcgccgagatcatc
cgcctgtgggtggcctcgaccgattactccggcgaactgtcgatctccgacgagatcctg
aagcgcgtggtggaaggctatcgccgcatccgcaacacgctgcgcttcctgctggccaac
ctggccgactacgaccacgcgcagcacgcgctgccggcgtcggaatggctggaaatcgac
cgctacgcggtggctctgacggggcgcctgcaacaggaaatcctgtcgcactacgatggc
tacgagttccacccggtggtcgccaagctgcagaccttctgctcggaagacctggggggc
ttctacctggacgtgctgaaggaccgcctctacaccaccgcggccaacgcgaaggaacgc
cgcgccgcgcagaacgccgtgtaccacatcacccaggcgatgctgcactggatggcaccg
ttcctgtcgttcacggcggaagaagcctggcagatcttcggccatggcaccgagcacacc
gacaccatcttcaccagcacctactacgacgtgccggcgatcgaccaggccgacgacctg
ttgcagaagtggcacgtgatccgcgaagcccgcgccgaagtcaccaagcagctcgaagcg
gtgcgcgtggacggcgagatcggttcctcactgcaagccgaagtcaccatccaggccggc
ggcccggtgctggccgcgctgcagagcctgtccgacgacctgcgcttcgtgctgctgacg
tccgctgccaaggtagccccggcgccggaaggcggcgacctgctggttaccgtgacgccg
tcggtgcacgccaagtgcgagcgttgctggcactaccgtgccgacgttggccgcgacccg
gcccaccccaccctttgcggccgctgtgacagcaacctgttcggcgccggtgaacacagg
agccacgcctga

DBGET integrated database retrieval system