KEGG   Cupriavidus basilensis: RR42_m3571Help
Entry
RR42_m3571        CDS       T03642                                 

Definition
(GenBank) Leucyl-tRNA synthetase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
cbw  Cupriavidus basilensis
Pathway
cbw00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cbw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RR42_m3571
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbw01007]
    RR42_m3571
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cbw03016]
    RR42_m3571
   03029 Mitochondrial biogenesis [BR:cbw03029]
    RR42_m3571
Enzymes [BR:cbw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     RR42_m3571
Amino acid related enzymes [BR:cbw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RR42_m3571
Transfer RNA biogenesis [BR:cbw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RR42_m3571
 Prokaryotic type
    RR42_m3571
Mitochondrial biogenesis [BR:cbw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RR42_m3571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1_2 tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AJG20937
UniProt: A0A0C4Y682
Position
main:complement(3796059..3798758)
Genome map
AA seq 899 aa AA seqDB search
MPAAYLFHAFRTPTHRAVVLNMQDKYLPSAVEQAAQQHWQAIDAYRVSEEAKLADGSEKP
KFYACSMLPYPSGKLHMGHVRNYTINDMMARHLRMNGHNVLMPMGWDAFGMPAENAALNN
GVAPAAWTYNNIAEMKRQMQSMGLAIDWSREVATCSPDYYRWNQWLFLKMLEKGIAYRKT
GTVNWDPVDQTVLANEQVIDGRGWRSGALVEKREIPMYYLRITDYAEELLGDLDDLGWPE
RVKIMQQNWIGKSVGVRFGFTHAIAGDDGKLIGDGKLYVFTTRADTIMGVTFCAVAAEHP
LATHAAATNPELAAFINECKHGSVMEADMATMEKKGMPTGLKVVHPLTGEQVEVWVGNYV
LMSYGDGAVMGVPAHDERDFAFANKYGLPIKQVVDMVDAKKGQPFSTEAWQEWYGDKEHG
TCIHSGKYDGLDYKAAVEAIAADLGAKGLGEKKITWRLRDWGISRQRYWGTPIPLIHCDG
CGVVPVPEQDLPVVLPEDLVPDGTGNPLAKDPRFLACTCPSCGKPARRETDTMDTFIDSC
WYYMRYTCPDAATMVDARNDYWMPMDQYIGGIEHAILHLLYARFWTKVMRDMGLVTFNEP
FSNLLTQGMVLNDTYYREDAAGKKTWYNPAEVDVSTDERGRPLGAVLKADGQPVVIGGVE
KMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSGSGVEGASRFLRRVWNYGY
ANAEAIAAAGNAVPSGDADAALRREIHGVLKQANYDYQRIQYNTVVSATMKMLNALEDAK
QATPAARREGLGILLRVLYPVVPHITHGLWQELGYATQYGDLLDAAWPQVDESALVQSEL
DLVLQINGKVRGSLKVPAVADRAAIEAMAAASEIVARFAEGAAPKKIVVVPGRLVNVVL
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgccgcttatcttttccacgcttttcgcacgccgacgcaccgcgccgttgtcctg
aacatgcaagacaaatatcttccctcagccgttgaacaagccgcccagcaacactggcaa
gccatcgatgcctaccgcgtatcggaagaggcgaagctggccgacggcagcgagaagccg
aagttctatgcctgctcgatgctgccttacccgtcgggcaagctgcatatgggccacgtg
cgcaactacaccatcaacgacatgatggcgcgccatctgcgcatgaatgggcacaacgtg
ctgatgccgatgggctgggatgcgttcggcatgccggcggaaaacgccgcgctcaacaat
ggcgtggcgcccgcagcctggacttacaacaacatcgctgaaatgaagcggcagatgcag
tcgatgggcctggccatcgactggtcgcgcgaagtcgccacctgcagcccggactactac
cgctggaaccagtggctgttcctcaagatgctggaaaagggcatcgcctaccgcaagact
ggcacggtgaactgggatccggtcgaccagaccgtgctggccaatgagcaggtcatcgac
gggcgcgggtggcgctcgggcgcgctggttgaaaagcgcgagatcccgatgtactacctg
cgcatcaccgattacgccgaggaactgctcggcgatctggacgacctgggctggcccgag
cgcgtcaagatcatgcagcagaactggatcggcaagagcgtgggcgtgcgcttcgggttt
acgcatgccatcgccggtgacgacggcaagctgatcggcgacggcaagctctatgtgttc
accacgcgcgccgacaccatcatgggcgtgactttctgcgcggtcgccgccgagcacccg
ctggccacccatgccgccgcgaccaatcctgagttggccgccttcatcaacgagtgcaag
cacggctcggtgatggaagccgatatggcgaccatggaaaagaagggcatgcccaccggc
ctgaaggttgtgcaccccctgaccggcgagcaggtcgaggtgtgggttggcaactacgtg
ctgatgagctacggcgacggcgctgtgatgggcgtgcccgcgcacgacgagcgcgacttc
gcctttgccaacaagtacggcttgccgatcaagcaagtggtcgacatggttgacgccaaa
aagggccagccgttctccaccgaagcctggcaggagtggtatggcgacaaggagcacggc
acctgcatccatagcggcaaatacgacggcctggactacaaggctgcggtagaagccatc
gcagccgatctcggtgccaagggcctgggcgagaagaagatcacctggcgtctgcgcgac
tggggcatctcgcgccagcgctactggggcacgccgatcccgctgatccattgcgacggc
tgcggcgtggtgccggtgccggagcaggacctgccggtggtgctgccggaagacctggtg
ccggacggcaccggcaacccgctggccaaggacccgcgtttcctcgcgtgcacctgcccg
tcgtgcggcaagccggcgcgccgcgagaccgacaccatggataccttcatcgattcgtgc
tggtattacatgcgctatacctgcccggacgcggccaccatggtcgacgcgcgcaacgac
tactggatgcccatggaccagtacatcggcggcatcgagcacgcgatccttcacctgctg
tacgcccgtttctggaccaaggtcatgcgcgacatgggcctggtcacgttcaacgagccg
ttctccaacttgctcacgcagggcatggtgctcaacgatacctactaccgcgaggacgcg
gcgggcaagaagacctggtacaacccggccgaagtcgacgtcagcaccgatgagcgcggc
cgcccgctgggcgccgtgctcaaggcggatggccagccggtggtgatcggcggcgtggag
aagatgtcgaagtccaagaacaacggcatcgacccgcaggccctgatcgaccagtacggc
gccgacaccgcgcgcctgttcgtcatgttcgccgcgccgcccgagcagcagctcgagtgg
agcggctcgggcgtggagggcgcttcgcgcttcctgcgccgggtgtggaactatggctat
gccaacgccgaggcgattgcagcggcgggcaatgccgtgccgtccggcgacgccgacgca
gcgctgcgtcgcgagatccacggcgtgctcaagcaggccaactacgactatcagcgcatc
cagtacaacaccgtggtgtccgccaccatgaagatgctcaacgcgctggaagacgccaag
caggccacgcccgccgcgcgccgcgagggcctgggcatcctgctgcgcgtgctgtacccg
gtggtgccgcacatcacccacgggctgtggcaagagctcggctacgccacgcagtacggc
gacttgctcgacgcagcgtggccgcaggtggacgaatccgcgctggtgcaaagcgagctg
gacctcgtgctgcagatcaacggcaaggtgcgcggcagcctgaaggtgccggccgttgcc
gatcgcgccgccatcgaggccatggccgccgccagcgagattgttgccaggttcgctgaa
ggcgccgcgccgaagaagatcgtggtggtcccgggccgcctcgttaacgtggttctttaa

DBGET integrated database retrieval system